Home | Manufacturer Directory | UPC Lookup | Wanted Manuals | Information Pages |
Register Login | Members Area |

Back To Frigidaire Refrigerator       Model: FRT15B3AQ1 Frigidaire Top Freezer Refrigerator Owners Manual
Regular Text Search or Search by Model Number

Register / log-in to add to your Hammerwall Collection.
Manual Location

Upload a pic of this item

Manuals For Same Model Number.
FRT15B3AQ1 Frigidaire Manual de uso y cuidado Refrigerador...
FRT15B3AQ1 Frigidaire Manuel d'utilisation et d'entretien ...
FRT15B3AQ1 Frigidaire Automatic Defrost top Freezer Refrig...
FRT15B3AQ1 Frigidaire Refrigerator Installation Guide...
FRT15B3AQ1 Frigidaire Top Freezer Refrigerator Parts And D...

Other Model Numbers Referenced to The Same Manual.
FRT21R6AW1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21R6AQ1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21R6AB1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P5AW2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P5AQ2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P5AB2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21C5AW2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21C5AQ2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21B4AW1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21B4AQ1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21G3AW1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21G3AQ1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18S6AW2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18S6AQ2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18R6AW2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18R6AW0 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18R6AQ2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18R6AQ0 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18P5AW2 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT18P5AQ2 Frigidaire Top Freezer Refrigerator Owners Manu...

Other Items that are in the Same Category.
Unknown Frigidaire Top Mount Refrigerators...
Frigidaire Side by Side Refrigerator Manual...
Frigidaire top Mount Refrigerator...
Frigidaire Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Top Mount Refrigerator...
Frigidaire Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Refrigerator...

This is a partial text extraction from the pdf, to download the pdf, click the Manual tab. If you want to search this text, hold control and F, and type the word you are looking for.

Page: 1

P / N 240400103 ( 0104 )
Page: 2

Welcome & Congratulations Congratulations on your purchase of a newrefrigerator ! We Questions ? here at Electrolux Home Products are very proud of our product and we are completly committed to providing you 1 - 800 - 944 - 9044 with the best service possible . Your satisfaction is our # 1 ( United States ) priority . Please read this Use & Care Manual very carefully . It contains 1 - 866 - 213 - 9397 valuable information on how to properly maintain your new ( Canada ) refrigerator . We know you � ll enjoy your newrefrigerator and Thank You Extend Your Warranty Protection for choosing our product . We hope you consider us for future purchases . With An PLEASE READ AND SAVE THESE INSTRUCTIONS Electrolux Service Contract This Use & Care Manual provides specific operating instructions for your model . Use your refrigerator only as instructed in this manual . These instructions are not meant L A C L 1 - 7 0 6 - 8 6 0 - 4 1 1 0 to cover every possible condition and situation that may To Enjoy These Benefits : occur . Common sense and caution must be practiced when installing , operating and maintaining any appliance . Please record your model and serial numbers below for • T o t a l f r e e d o m f r o m r e p a i r b i l l s o s future reference . This information is found on your serial ruoytesput’nowsriaperdetcepxenu plate located inside the refrigerator compartment . . t e g d u b NOTE : Use only soap and water to clean serial plate . • e c i v r e s e e r f - l l o t t n e i n e v n o c , t s a F i s j u s t . y a w a l l a c e n o h p a Model Number : • sr ia p er y ti l au q - po T byfactory - trained Serial Number : e x p e r t s . Purchase Date : • t n e m e c a l p e r e n i u n e g o t s s e c c a k c i u Q t r a p s ruoyderussatsernacuoyos r e p o r p e h t h t i w d e r i a p e r s i r o t a r e g i r f e r . s t n e n o p m o c Please attach sales receipt here for future reference . ehtniliamdnaetelpmocesaelP t c u d o r P RegistrationCard includedwithyour refrigerator . 2
Page: 3

Important Safety Instructions WARNING : Please Read All Instructions Before Using This Refrigerator . FOR YOUR SAFETY PROPER DISPOSAL OF YOUR REFRIGERATOR OR FREEZER � Donotstoreorusegasoline , orotherflammableliquids in the vicinity of this or any other appliance . Read pro - Risk of child entrapment duct labels for warnings regarding flammability and other Childentrapmentand hazards . suffocation are not problems of � Donotoperatetherefrigeratorinthepresenseof the past . Junked or abondoned explosive fumes . refrigerators or freezers are still � Avoidcontactwithanymovingpartsofautomaticice dangerous � even if they will sit maker . for � just a few days . � If you are � Removeallstablesfromthecarton . Staplescancause getting rid of your old refrigerator severe cuts , and also destroy finishes if they come in or freezer , please follow the contact with other appliances or furniture . instructions below to help prevent accidents . CHILD SAFETY Destroy or recycle the carton , plastic bags , and any exterior Before you throw away your old refrigerator / freezer : wrapping material immediately after the refrigerator is � Removedoors . unpacked . Children shouldNEVER use these items to play . � Leaveshelvesinplacesochildrenmaynoteasilyclimb Cartons covered with rugs , bedspreads , plastic sheets or inside . stretch wrap may become airtight chambers , and can � Haverefrigerantremovedbyaqualifiedservice quickly cause suffocation . technician . These Guidelines Must Be Followed To Ensure That Safety Mechanisms In This Refrigerator Will Operate Properly . ELECTRICALTIIONNFORMA NOTE : Turning the refrigerator temperature control to � The refrigerator must be plugged into its own � 0 � turns off the compressor , but does not disconnect dedicated 115 Volt , 60 Hz . , AC only electric outlet . electrical power to the light bulb or other electrical The power cord of the appliance is equipped with a three - prong grounding plug for your protection against components . electrical shock hazards . It must be plugged directly into a properly grounded three - prong receptacle . The receptacle must be installed in accordance with local codes and ordinances . Consult a qualified electrician . Do not use an extension cord or adapter plug . � Immediatelyrepairorreplaceanypowercordthat becomes frayed or damaged . � Neverunplugtherefrigeratorbypullingonthepower cord . Always grip the plug firmly , and pull straight out from the receptacle to prevent damaging the power cord . � Unplugtherefrigeratorbeforecleaningandbefore replacing a light bulb to avoid electrical shock . � Performancemaybeaffectedifthevoltagevariesby 10 % or more . Operating the refrigerator with insufficient power can damage the compressor . Such damage is not covered under your warranty . � Donotplugtheunitintoanoutletcontrolledbyawall switch or pull cord to prevent the refrigerator from being turned off accidentally . � AvoidconnectingrefrigeratortoaGroundFault Interruptor ( GFI ) circuit . 3
Page: 4

Installation This Use & Care Manual provides specific operating LEVELING instructions for your model . Use the refrigerator only as All four corners of your refrigerator must rest firmly on a instructed in this Use & Care Manual . Before starting the solid floor . Your refrigerator is equipped with adjustable front refrigerator , follow these important first steps . rollers to help level your unit . To Level Your Refrigerator : LOCATION 1 . Removetoegrille . � Chooseaplacethatisnearagroundedelectricaloutlet . Do Not use an extension cord or an adapter plug . � If possible , place the refrigerator out of direct sunlight and away from the range , dishwasher or other heat sources . � Therefrigeratormustbeinstalledonafloorthatislevel and strong enough to support a fully loaded refrigerator . � Considerwatersupplyavailabilityformodelsequipped with an automatic ice maker . INSTALLATION � Do Not install the refrigerator where the temperature will drop below 55 � F ( 13 � C ) or rise above 110 � F ( 43 � C ) . The compressor will not be able to maintain proper temperatures inside the refrigerator . Do Not block the toe grille on the lower front of your refrigerator . Sufficient air circulation is essential for the proper operation of your refrigerator . 2 . Useflat - bladescrewdriveror3 / 8 � socketwrench to adjust front rollers . Installation Clearances � Allowthefollowingclearancesforeaseofinstallation , NOTE : Raise the front of the refrigerator enough so the proper air circulation , and plumbing and electrical doors close freely when opened halfway . The refrigerator connections : should slope … � to ‰ � from front - to - back . Then level the refrigerator from side to side . Sides & Top - - - - - - - - - - - - - 3 / 8 � Back - - - - - - - - - - - - - - - - - - - - 1 � NOTE : If you see black coils / tubing on the back of your refrigerator ( air - cooled condenser ) leave 3 � clearance at top of refrigerator . DOOR OPENING NOTE : If your refrigerator is placed with the door hinge side against a wall , you may have to allow additional space so the door can be opened wider . Your refrigerator should be positioned to allow easy access to a counter when removing food . To make this possible , the direction in which the doors open can be reversed . See Door Removal & Reversal Instructionson page 6 . 4
Page: 5

Installation - Connecting Optional Ice Maker To Water Supply To avoid electric shock , which can cause death or severe personal injury , disconnect the refrigerator from electrical power before connecting a water supply line to the refrigerator . To Avoid Property Damage : � Copper tubing is recommended for the water supply line . Water supply tubing made of … � plastic is not recommended since it greatly increases the potential for water leaks . Manufacturer will not be responsible for any damage if plastic tubing is used for supply line . � DONOTinstallwatersupplytubinginareaswheretemperaturesfallbelowfreezing . � Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . IMPORTANT : Ensure that your water supply line connections comply with all local plumbing codes . Before Installing The Water Supply Line , You Will Need TM � Basic Tools : adjustable wrench , flat - blade screwdriver , and Phillips screwdriver � Accesstoahouseholdcoldwaterlinewithwaterpressurebetween20and120psi . � A water supply line made of … inch ( 6.4 mm ) OD , copper tubing . To determine the length of copper tubing needed , you will need to measure the distance from the ice maker inlet valve at the back of the refrigerator to your cold water pipe . Then add approximately 7 feet ( 2.1 meters ) , so the refrigerator can be moved out for cleaning ( as shown ) . � A shutoff valve to connect the water supply line to your household water system . DO NOT use a self - piercing type shutoff valve . � A compression nut and ferrule ( sleeve ) for connecting the water supply line to the ice maker inlet valve . NOTE : Water line kit number 5303917950 , available from your appliance dealer at additional cost , contains 25 feet ( 7.6 meters ) of … inch OD copper tubing , a saddle type shutoff valve ( nonpiercing ) , ( 2 ) … inch brass compression nuts , ( 2 ) ferrules / sleeves , and instructions for installing a water supply line . To Connect Water Supply Line To Ice Maker Inlet Valve 1 . Disconnectrefrigeratorfromelectricpowersource . 2 . Placeendofwatersupplylineintosinkorbucket . Turn ON water supply and flush supply line until water is clear . Turn OFF water supply at shut off valve . 3 . Unscrewplasticcapfromwatervalveinletanddiscardcap . 4 . Slidebrasscompressionnut , thenferrule ( sleeve ) ontowatersupplyline , as shown . 5 . Pushwatersupplylineintowatervalveinletasfarasitwillgo ( … inch ) . Slide ferrule ( sleeve ) into valve inlet and finger tighten compression nut onto valve . Tighten another half turn with a wrench ; DO NOT over tighten . 6 . Withsteelclampandscrew , secure water supply line to rear panel of refrigerator as shown . 7 . Coilexcesswatersupplyline ( about2 ‰ turns ) behindrefrigeratorasshown and arrange coils so they do not vibrate or wear against any other surface . 8 . Turn ON water supply at shutoff valve and tighten any connections that leak . 9 . Reconnectrefrigeratortoelectricalpowersource . 10 . To turn ice maker on , lower wire signal arm ( see ice maker front cover for ON / OFF position of arm ) . IMPORTANT : It takes approximately 24 hours for the ice maker to begin producing ice . Air in new plumbing lines may cause ice maker to cycle two or three times before making a full tray of ice . New plumbing may cause ice to be discolored or have poor flavor . Discard ice made during the first 24hours . 5
Page: 6

Door Removal and Reversal Instructions DOOR REMOVAL AND REVERSAL INSTRUCTIONS : NOTE : If you have stainless steel doors - - go to theRemoving Stainless Steel Doors and HandlesSection on page 9 . NOTE : The direction in which your refrigerator doors open ( door swing ) can be reversed , from left to right or right to left , by moving the door hinges from one side to the other . Reversing the door swing should be performed by a qualified person . IMPORTANT : Before you begin , turn the refrigerator temperature control to � 0 � and remove the electrical power cord from the wall outlet . Remove any food from door shelves . 1 . Removetoegrilleandtophingecover . 2 . Removetophingewith3 / 8 � hexdriverandliftfreezerdooroffof center hinge pin . Set door aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewand loosening two outside screws enough to allow hinge and shim to slide out . Tighten screws . 6 . Loosentwooutsidescrewsonoppositesideofrefrigerator , remove inside screw and install center hinge . 7 . Removebottomhingewith3 / 8 � hexdriver . Reinsert two outside screws in holes and tighten . Inside screw will go to opposite side in step 8 . 8 . Removetwooutsidescrewsonoppositesideofrefrigeratorandinstall bottom hinge . Insert and tighten screw saved from step 7 . 9 . Unscrewbottomhingepinusingadjustablewrench . Movehingepin to other hole in hinge and tighten with adjustable wrench . 10 . Reversedoorhandles ( seeinstructionsonnextpage ) . 11 . Movefreezerandrefrigeratordoorstopstooppositeside . Before starting screws , use an awl to puncture the foam . 12 . Positionrefrigeratordoorontobottomhingepinandscrewcenter hinge pin through center hinge into top of door . Close refrigerator door to help align hinge hole . 13 . Tightencenterhingepinwithadjustablewrench . 14 . Removecabinetandhingeholeplugsandmovetooppositeside . 15 . Lowerfreezerdoorontocenterhingepin . 16 . Closefreezer door . Have an assistant lift up on opposite side of door while tightening screws to install top hinge . 17 . Replacetoegrilleandtophingecover . 18 . Pluginelectricalpowercordandturnrefrigeratortemperaturecontrol to center position . Adjust setting as necessary . 6
Page: 7

Door Removal and Reversal Instructions ( continued ) NOTE : Some models have � pocket � handles , which are recessed into the sides of the door . On these models , only the hinges will need to be reversed . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Removeshorttrimpiecebyslidingtrimstraightupandoffofhandle bracket . 3 . Removescrew attaching top of handle to door . 4 . Magnetic Nameplate Models : Gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Gently peel off nameplate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Reinstallhandleonoppositeside , usingsameholeasnameplate . 2 . Attachhandletobottomofdoor . 3 . Slidetrimpiecestraightdownontohandlebracket . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Swingbottomofhandleawayfromthedoorandslidehandlestraightup and off of dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , usingthe same holes as nameplate . 4 . Magnetic Nameplate Models : Use putty knife to gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Use putty knife to gently peel off name plate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Startwithhandleoffset away from door . Place top of handle over dovetail button , swing handle into an upright position and pull downward , locking it into place . 2 . Secure bottom of handle with two screws removed earlier . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideoffreezerdoorandremovehandle . TO ATTACH FREEZER HANDLE : 1 . Securesideofhandletodoorandreplacebuttonplug . 2 . Secure handle to bottom of door . NOTE : To remove freezer handle , refer to figure 3 on page 9 . 7
Page: 8

Door Removal and Reversal Instructions ( continued ) TRIM REMOVAL ( FULL - LENGTH TRIM MODELS ONLY ) In some models , the refrigerator door has a full length trim piece which continues from the bottom of the handle to the bottom of the door . The top of the trim attaches to the handle bracket ( Figure 1 ) or fits around the base of the handle ( Figure 2 ) . An adhesive � trim lock � is positioned about halfway down . The bottom of the trim is held in place by either an adhesive trim lock , or a trim lock with two prongs inserted into a hole on the face of the door . TO REMOVE TRIM : 1 . Removetrimbygentlypullingtrimlockareas out and away from door . 2 . Whentrimisfree from door , slide the trim straight down and away from base of handle . NOTE : For models with short handle trim , remove by sliding trim straight down and off of handle bracket . TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) Figure 1 Style Handles 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Removescrew attaching bottom of handle to door . 3 . Removetwoholeplugsandhingepinplugontopofdoorandinstall on opposite side . Use Phillips head screwdriver to remove plastic Figure 1 screw plug from front of door and install on opposite side Figure 2 Style Handles 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Swingtopofhandleawayfromdoorandslidehandledownandoffof dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , moving hole plugs from corresponding holes to opposite side . TO ATTACH REFRIGERATOR HANDLE : Figure 1 Style Handles 1 . Securebottomofhandlewithscrews . 2 . Securetopofhandlewithscrews . Figure 2 Style Handles 1 . Startwithhandleoffset away from door . Place bottom of handle over dovetail button , swing handle into an upright position and pull upward , locking it into place . 2 . Securetopofhandlewithscrews . TO ATTACH TRIM : 1 . Slidebothtrimlocksoutoftrim . 2 . Insertnewadhesivetrimlockscontainedinyourliteraturepack . NOTE : Trim lock must be removed and installed by sliding over the two donut shaped areas . Figure 2 3 . Installtrimtohandlebyslidingunderbaseofhandle . Carefullyalign trim and press down at trim lock locations . 4 . Userubbingalcoholtoremoveanyadhesiveresiduefromoldtrim lock locations . 8
Page: 9

Door Removal and Reversal Instructions ( continued ) TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideofrefrigeratordoorandremovehandle . 4 . Reversefreezerandrefrigeratorhandlesasshowninfigure3 . Refrigerator Door Without Trim TO ATTACH REFRIGERATOR HANDLE : 1 . Securesideofhandletodoorandreplaceplugbutton . 2 . Secure handle to top of door . Figure 3 - Handle Reversal REMOVING STAINLESS STEEL DOORS AND HANDLES Use care when using tools near surface of stainless steel doors to avoid scratching . To Remove Doors Stainless steel doors are not reversible . Follow these steps to remove doors . 1 . Removetoegrilleandtophingecover . 2 . Removetophingeandliftfreezerdooroffofcenterhingepin . Setdoor aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewandloosening two outside screws enough to allow hinge to slide out . 6 . Removebottomhinge . Reinserttwooutsidescrewsinholesandtighten . 7 . Reversesteps1 - 6toreinstalldoors To Remove Handles 1 . Firmlyholdfreezerhandlewhilelooseningsetscrewswith3 / 32 � allen Typical Handle wrench . Remove freezer handle . 2 . Repeatstep1forrefrigeratordoor . 9
Page: 10

Features At A Glance Features may vary according to model 10
Page: 11

Temperature Controls COOL DOWN PERIOD To ensure safe food storage , allow the refrigerator to operate with the doors closed for at least 8 to 12 hours before loading it with food . REFRIGERATOR & FREEZER CONTROLS NOTE : When first setting the controls or when changing a setting , wait 24 hours for the temperature to stabilize before making additional changes . TEMPERATURE ADJUSTMENT : E T O N r o t a r e g i r f e r e v o m , n o r o t a r e g i r f e r g n i n r u t t s r i f n e h W o t s l o r t n o c r e z e e r f d n a ▼ d e d n e m m o c e r e h t s i h c i h w . d e d e e n s a s l o r t n o c e h t t s u j d a , s r u o h 4 2 r e t f A . g n i t t e s l a i t i n i � Adjust temperature gradually : move the knob in small increments , allowing the temperature to stabilize . � Forcoldertemperatures , turntheknobtowardsCold . Freezer Control ( some models ) � Forwarmertemperatures , turntheknobtowardsWarm . Turning the refrigerator control will change temperatures in both compartments . For example , if the refrigerator control is turned to a colder setting , the freezer control may have to be adjusted to a warmer setting . Turning the freezer control will change only the freezer temperature . To maintain temperatures , a fan circulates air in the refrigerator and freezer compartments . For good circulation , do not block cold air vents with food items . Refrigerator Control ( some models ) IMPORTANT : Turning the refrigerator temp - erature control to � 0 � turns off the com - pressor , but does not disconnect the power to the light bulb and other electrical components . Refrigerator & Freezer Control ( some models ) T E M P E R A T U R E A D J U S T M E N T G U I D E T u r n R e f r i g e r a t o r C o n t r o l S l i g h t l y T o w a r d s C o l d . I f R e f r i g e r a t o r c o m p a r t m e n t I s T o o W a r m T u r n R e f r i g e r a t o r C o n t r o l S l i g h t l y T o w a r d s W a r m . I f R e f r i g e r a t o r c o m p a r t m e n t I s T o o C o l d T u r n F r e e z e r C o n t r o l S l i g h t l y T o w a r d s C o l d e r . I f F r e e z e r c o m p a r t m e n t I s T o o W a r m T u r n F r e e z e r C o n t r o l S l i g h t l y T o w a r d s W a r m e r . I f F r e e z e r c o m p a r t m e n t I s T o o C o l d T o T u r n R e f r i g e r a t o r O f f 0 . T u r n R e f r i g e r a t o r C o n t r o l T o 11
Page: 12

Looking Inside To avoid personal injury or property damage , handle tempered glass shelves carefully . Shelves may break suddenly if nicked , scratched , or exposed to sudden temperature change . SHELF ADJUSTMENT Refrigerator shelves are easily adjusted to suit individual needs . Before adjusting the shelves , remove all food . To adjust sliding shelves : 1 Remove shelf by pulling forward to stop position . 2 Lift front edge up and pull out . Replace the shelf on any pair of rails by reversing this procedure . Sliding Wire Shelf To adjust cantilever shelves : NOTE : Cantilever shelves are supported at the back of the refrigerator . Cantilever shelves are available in either glass or wire . 1 Lift front edge up . 2 Pull shelf out . Replace the shelf by inserting the hooks at rear of the shelf into the wall bracket . Lower the shelf into the desired slots and lock into position . TM SpillSafe glass shelves ( some models ) catch and hold accidental spills . In TM some models , the SpillSafe shelves slide out for easy access to food and Sliding Glass Shelf for fast cleaning . The shelves slide out independently of the cantilever brackets . Just pull the front of the shelf forward . The shelf can be extended as far as the stopper will allow but it is not removable from the cantilever bracket . Full Width Cantilever Glass Shelf Cantilever Glass Shelf - Fixed and Sliding 12
Page: 13

Looking Inside ( continued ) DOOR STORAGE TALL BOTTLE RETAINER ( SOME MODELS ) Door bins , shelves , and racks are provided for convenient The Tall Bottle Retainer keeps tall containers in the bin from storage of jars , bottles , and cans . Frequently used items falling forward when opening or closing the refrigerator door . can be quickly selected . To install , hold the retainer at the top , and slide it over the outside wall of the bin , as shown in the diagram . The Tall Some models have door racks or bins that can Bottle Retainer works best with a Bin Snugger . accommodate gallon - sized plastic drink containers and economy - sized jars and containers . Some racks are adjustable for maximum storage capacity . The dairy compartment , which is warmer than the general food storage section , is intended for short term storage of cheese , spreads , or butter . Tall Bottle Retainer ( left ) and Bin Snugger ( right ) SPECIAL ITEM RACK ( SOME MODELS ) The innovative design of the Special Item Rack allows you to store a six - pack of 12 ounce drink cans , a bottle of wine , a two - liter soft drink bottle , or a carton of eggs . The Special Item Rack mounts on the left side of your refrigerator . To install , just slide the Special Item Rack onto any shelf as Door Rack shown in the drawing . ADJUSTABLE DOOR BINS Some models have adjustable door bins that can be moved to suit individual needs . To move door bins 1 . Lift bin straight up . 2 . Remove bin . 3 . Place bin in desired position . 4 . Lower bin onto supports until locked in place . Special Item Rack Adjustable Door Bin 13
Page: 14

Looking Inside - ( continued ) CRISPERS ( SOME MODELS ) DELI DRAWER ( SOME MODELS ) The crispers , located under the bottom refrigerator shelf , Some models are equipped with a Deli Drawer for storage are designed for storing fruits , vegetables , and other fresh of luncheon meats , spreads , cheeses , and other deli items . produce . Wash items in clear water and remove excess water before placing them in the crispers . Items with strong odors or high moisture content should be wrapped before storing . Deli Drawer WINE RACK ( SOME MODELS ) The Wine Rack stores bottles of wine , or single two - liter Crisper Drawer plastic bottles of juice or soda pop . To install , slide the Wine Rack onto the shelf with the curve facing in . To remove , slide the Wine Rack out . Install on either side of shelf . HUMIDITY CONTROL ( SOME MODELS ) The Humidity Control , present on some models with crisper drawers , allows you to adjust the humidity within the crisper . This can extend the life of fresh vegetables that keep best in high humidity . NOTE : Leafy vegetables keep best when stored with the Humidity Control set on High Humidity , or in a drawer without a Humidity Control . This keeps incoming air to a minimum and maintains maximum moisture content . Wine Rack Crisper Humidity Control 14
Page: 15

Ice Service If your refrigerator has an automatic ice maker , it will provide a sufficient supply of ice for normal use . During the initial startup of your refrigerator , however , no ice will be produced during the first 24 hours of operation . Automatic ice makers are also optional accessories that may be installed in most models at any time . Call your local dealer for information . TURNING YOUR ICE MAKER ON After the plumbing connections have been completed , the water supply valve must be opened . Place the ice container under the ice maker , pushing it as far back as possible . Lower the wire signal arm to its � down � or ON position . New plumbing connections may cause the first production of ice cubes to be discolored or have an odd flavor . These first cubes should be discarded until the cubes produced are free of discoloration and taste . TURNING YOUR ICE MAKER OFF To stop the ice maker , lift the wire signal arm until it clicks and locks in the Ice Maker � up � or OFF position . The ice maker also turns off automatically when the ice container is full . If your model has an adjustable freezer shelf , place the shelf in the lower position , so that the wire signal arm will hit the ice when the container is full . Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . ICE MAKER TIPS � Icecubesstored too long may develop an odd flavor . Empty the ice container and ensure that the wire signal arm is in its � down � or ON position . The ice maker will then produce more ice . � Occasionallyshaketheicecontainertokeepiceseparated . � Keepthewiresignalarminits � up � orOFFpositionuntiltherefrigeratorisconnectedtothewatersupplyorwhenever the water supply is turned off . � Thefollowingsoundsarenormalwhentheicemakerisoperating : � Motorrunning � Icelooseningfromtray � Ice dropping into ice container � Runningwater � Watervalveopeningorclosing NOTE : For more information on these operations , seeNormal Operating Sounds and Sightssection on page 17 . Do Not place the ice container in your dishwasher . � Wash the ice container in warm water with mild detergent . Rinse well and dry . � Stoptheicemakerwhencleaningthefreezerandduringvacations . � Iftheicemakerwillbeturnedoffforalongperiodoftime , turnthewatersupplyvalvetotheclosedposition . 15
Page: 16

Food Storage & Energy Saving Ideas FOOD STORAGE IDEAS Fresh Food Storage � Thefresh food compartment should be kept between 34 � F and 40 � F with an optimum temperature of 37 � F . � Avoidovercrowdingtherefrigeratorshelves . Thisreducesthecirculationofairaroundthefoodandresultsinuneven cooling . Fruits and Vegetables � Storageinthecrisperdrawerstrapsmoisturetohelppreservethefruitandvegetablequalityforlongertimeperiods . Meat � Rawmeatandpoultryshouldbewrappedsecurelysoleakageandcontaminationofotherfoodsorsurfacesdoesnot occur . Frozen Food Storage � Thefreezer compartment should be kept at 0 � F or lower . � A freezer operates most efficiently when it is at least 2 / 3 full . Packaging Foods for Freezing � To minimize dehydration and quality deterioration , use aluminum foil , freezer wrap , freezer bags or airtight containers . Force as much air out of the packages as possible and seal them tightly . Trapped air can cause food to dry out , change color , and develop an off - flavor ( freezer burn ) . � Wrapfreshmeatsandpoultrywithsuitablefreezerwrappriortofreezing . � Donotrefreezemeatthathascompletelythawed . Loading the Freezer � Avoid adding too much warm food to the freezer at one time . This overloads the freezer , slows the rate of freezing , and can raise the temperature of frozen foods . � Leaveaspacebetweenthepackages , socoldaircancirculatefreely , allowing food to freeze as quickly as possible . � Avoidstoringhard - to - freezefoodssuchasicecreamandorangejuiceonthefreezerdoorshelves . Thesefoodsare best stored in the freezer interior where the temperature varies less . ENERGY SAVING IDEAS � Locatetherefrigeratorinthecoolestpartoftheroom , outofdirectsunlight , and away from heating ducts or registers . Do not place the refrigerator next to heat - producing appliances such as a range , oven , or dishwasher . If this is not possible , a section of cabinetry or an added layer of insulation between the two appliances will help the refrigerator operate more efficiently . � Leveltherefrigerator so that the doors close tightly . � RefertothisUse & CareManualforthesuggestedtemperaturecontrol settings . � Periodiccleaningofthecondenserwillhelptherefrigeratorrunmore efficiently . See the Care and Cleaning Chart on page 18 . � Donotovercrowdtherefrigeratororblockcoldairvents . Doingsocauses the refrigerator to run longer and use more energy . � Coverfoodsandwipecontainersdrybeforeplacingtheminthe refrigerator . This cuts down on moisture build - up inside the unit . � Organizetherefrigeratortoreducedooropenings . Removeasmany items as needed at one time and close the door as soon as possible . 16
Page: 17

Normal Operating Sounds & Sights H E A R Y Y O U M A A N D I N G T H E S O U N D S U N D E R S T A . Evaporator The flow of refrigerant through the evaporator may Your new high - efficiency refrigerator may make unfamiliar create a boiling or gurgling sound . sounds . Don � t be alarmed , these are all normal sounds . Hard surfaces , such as vinyl or wood floors , walls , and B . Evaporator Fan kitchen cabinets may make sounds more noticeable . Listed You may hear air being forced through the refrigerator below are descriptions of some of the most common sounds by the evaporator fan . you may hear , and what is causing them . C . Defrost Heater NOTE : Rigid foam insulation is very energy efficient , During defrost cycles , water dripping onto the defrost but is not a sound insulator . heater may cause a hissing or sizzling sound . After defrosting , a popping sound may occur . IMPORTANT : During the automatic defrost cycle , you may notice a red glow in the vents on the back wall of your freezer compartment . This is normal during the defrost cycle . D . Automatic Ice Maker If your refrigerator is equipped with an automatic ice maker , you will hear ice cubes falling into the ice bin . E . Cold Control & Defrost Timer These parts can produce a snapping or clicking sound when turning the refrigerator on and off . The timer also produces sounds similar to an electric clock . F . Condenser Fan If condenser coils are located underneath your refrigerator as shown in the drawing at the left , you have a condenser fan . You may hear air being forced through the condenser by the condenser fan . G . Compressor Modern , high - efficiency compressors operate much faster than older models . The compressor may have a high - pitched hum or pulsating sound . H . Water Valve If your refrigerator is equipped with an automatic ice maker , you will hear a buzzing sound as the water valve opens to fill the ice maker during each cycle . I . Drain Pan ( Nonremovable ) You may hear water running into the drain pan during the defrost cycle . The drain pan will be located on top of the compressor for air - cooled condensers ( black coils on back of refrigerator ) . J . Condenser Coils ( Fan - cooled models only ) 17
Page: 18

Care & Cleaning Keep your refrigerator and freezer clean to prevent odor build - up . Wipe up any spills immediately and clean both sections at least twice a year . Never use metallic scouring pads , brushes , abrasive cleaners or strong alkaline solutions on any surface . Do not wash any removable parts in a dishwasher . Always unplug the electrical power cord from the wall outlet before cleaning . � When moving the refrigerator , pull straight out . Do not shift the refrigerator from side to side as this may tear or gouge the floor covering . If the refrigerator has an automatic ice maker , be careful not to move the refrigerator beyond the plumbing connections . � Dampobjectssticktocoldmetalsurfaces . Donottouchrefrigeratedsurfaceswithwetordamphands . � To avoid damage and help the refrigerator run as efficiently as possible , clean the condenser periodically . NOTES : � Turning the refrigerator temperature control to 0 � � turns off the compressor , but does not disconnect electrical power to the light bulb or other electrical components . � Donotuserazorbladesorothersharpinstrumentswhichcanscratchtheappliancesurfacewhenremoving adhesive labels . Any glue left from tape or labels can be removed with a mixture of warm water and mild detergent , or , touch the glue residue with the sticky side of tape you have already removed . Do not remove the serial plate . Care & Cleaning Chart Part What To Use Tips and Precautions Interior / Door Use 2 tablespoons of baking soda in 1 quart of warm water . Be sure to Soap and water • g excess water out of sponge or cloth before cleaning around wrin Liner Baking soda and water • controls , light bulb or any electrical part . Door Gaskets Wipe gaskets with a clean soft cloth . Soap and water • Soap and water • Drawers / Bins Do not wash any removable items ( bins , drawers , etc . ) in dishwasher . Allow glass to warm to room temperature before immersing in warm Soap and water • Glass Shelves water . Glass cleaner • Mild liquid sprays • Soap and water • Vacuum dust from front of toe grille . Remove toe grille ( See illustration on Toe Grille page 4 ) . Vacuum backside and wipe with sudsy cloth or sponge . Rinse Mild liquid sprays • and dry . Vacuumattachment • Soap and water • Exterior and Do not use commercial household cleaners , ammonia , or alcohol to clean Handles handles . Exterior and Soap and water • Clean stainless steel front and handles with soapy water . Use ammonia Handles on stubborn spots . Use a non - abrasive stainless steel cleaner . These Ammonia • ( Stainless cleaners can be purchased at most home improvement or major Stainless Steel • Steel Models department stores . Cleaners Only ) No need to clean unless operating refrigerator under particularly dusty or Condenser Cleaning • Condenser greasy conditions , or if there is significant pet traffic in your home . If Brush is available from Coils cleaning is necessary , remove toe grille and use extended vacuum your dealer . ( Fan - cooled attachment and condenser cleaning brush to remove dust build - up from VacuumCleaner • models only ) c o n d e n e s r c o s l i s ( e e t i e m “ J ” i n l i u l s r t t a o i n o n p a g e 1 7 f o r o l c t a o i n . ) Condenser U s e h t e d u s n i t g o t o l t a a t c h m e n t o n y o u r v c a u u m o t e r m o v e d s u t b u l i d u - p V a c u u m C l a e n e r • Coils o n h t e c o n d n e s e r c i o s l ( b a l k c u t b e s a n d w r i e s ) a t a t c e h d o t t h e b c a k f o a i - r ( Air - cooled c o o e l d e r r f g i e a r t o s r o n y l . models only ) S o m e m o d e s l h a v e d e r s f o t w a e t r p a n l c o a e t d n o o t p o f c o m p r s e s o r a t S o a p a n d w a e t r • Defrost Water b o t o t m e r a r o f e r r f g i e a r t o r ( s e e l l i s u t a r i t o n o n n e x t p a g e . ) W p i e w a e t r p a n Pan w i h t d a m p c o l h t . N O T E : T h e d e r s f o t w a e t r p a n s i N O T r e m o v b a l e . 18
Page: 19

Care & Cleaning ( continued ) NEVER CLEAN CONDENSER ( SOME MODELS ) Avoid cuts when replacing light bulbs , , r e s n e d n o c n a e l C r e v e N a h t i w d e p p i u q e s i r o t a r e g i r f e r r u o y f I wear gloves . g n i t a r e p o l a m r o n r e d n u r e s n e d n o c e h t n a e l c o t d e e n o n s ’ e r e h t c o n d i t i o n s . I f t h e r e f r i g e r a t o r i s o p e r a t e d u n d e r p a r t i c u l a r l y REPLACING THE FREEZER LIGHT BULB c i f f a r t t e p t n a c i f i n g i s s i e r e h t f i r o , s n o i t i d n o c y s a e r g r o y t s u d ( SOME MODELS ) i n y o u r h o m e , i t m a y b e n e c e s s a r y t o p e r i o d i c a l l y c l e a n t h e 1 . Unplugrefrigerator . f i c i e n c y . c o n d e n s e r f o r m a x i m u m e f 2 . Wear gloves as protection against possible broken glass . 3 . Unsnaplightshieldasshown . 4 . Unscrewandreplaceoldbulbwithanappliancebulb of the same wattage . 5 . Replacelightshield . 6 . Remembertoplugtherefrigeratorbackin . Defrost Water Pan ( some models ) Vacation and Moving Tips Leave refrigerator operating during vacations of 3 weeks or less . • Short • Use all perishable items from refrigerator compartment . Vacations • Turn automatic ice maker off , even if you will only be gone for a few days . • Remove all food and ice if you will be gone one month or more . Turn controls to “ ” 0 and disconnect power . • Turn off automatic ice maker and turn water supply valve to closed position . • Long • Clean interior thoroughly . Vacations Leave both doors open to prevent odors and mold build - up . Block doors open if • necessary . • Remove all food and ice . • If using handcart , load from side . o n i M v g Adjust rollers all the way up to protect them during sliding or moving . • Pad cabinet to avoid scratching surface . • 19
Page: 20

n o i t a m r o f n I y t n a r r a W Y T N A R R A W R O T A R E G I R F E R ytnarrawsihtybdetcetorpsirotaregirferruoY WARRANTY THROUGH OUR AUTHORIZED SERVICERS , THE CONSUMER WILL BE RESPONSIBLE FOR : PERIOD WE WILL : One year from original Pay all costs for repairing or replacing any parts of this Costs of service calls that are listed under NORMAL FULL ONE - YEAR purchase date appliance which prove to be defective in materials or RESPONSIBILITIES OF THE CONSUMER . * WARRANTY workmanship . Excludes original and replacement Ice & Water filter cartridges ( if equipped ) . Original and replacement cartridges are warranted for 30 days ( parts only ) . ND TH Second through fifth Repair or replace any parts in the cabinet liner or Costs for pick up and delivery of the appliance required because LIMITED 2 - 5 years from original Sealed Refrigeration System ( compressor , condenser , of service . Costs for labor , parts and transportation other than YEAR WARRANTY purchase date evaporator , drier and tubing ) which prove to be with respect to the cabinet liner or Sealed Refrigeration System . ( Cabinet Liner and defective in materials or workmanship . Sealed System ) Time periods listed All of the provisions of the full warranties above and rf o s s to c y n a d n a e m o h h'te i on cait n lh e ct ve a r t set h f os t s o C LIMITED above . the exclusions listed below apply . f o e s u c ae b d e ri u q e r c e n il p a a p e h tf o y r viel e d d n a u p cik p WARRANTY . v c i e r e s ( Applicable to the State of Alaska ) irtsudnIdetadilosnoCetihWfonoisivida , aciremAhtroNstcudorPemoHxulortcelEybdetnarrawsiecnailpparuoy , . A . S . UehtnI eW . cnIse rednu strap dna ecivres rof snoitagilbo ruO . ytnarraw siht rednu snoitagilbo ruo fo yna ot dda ro egnahc ot nosrep on ezirohtua tsum ytnarraw siht y b d e t n a r r a w s i e c n a i l p p a r u o y , a d a n a C n I . r e c i v r e s a c i r e m A h t r o N s t c u d o r P e m o H x u l o r t c e l E d e z i r o h t u a n a r o s u y b d e m r o f r e p e b . c n I a d a n a C I C W ehtrofelbisnopsersiremusnocehtdna , esudlohesuohyranidronistcudorpotylnoseilppaytnarrawsihTitemslistedbelow : * NORMAL RESPONSIBILITIES OFTHECONSUMER 1 . Properuseoftheapplianceinaccordancewithinstructionsprovidedwiththeproduct . 2 . Properinstallationbyanauthorizedservicerinaccordancewithinstructionsprovidedwiththeapplianceandin accordancewithalllocalplumbing , electricaland / orgascodes . 3 . Properconnectiontoagroundedpowersupplyofsufficientvoltage , replacementofblownfuses , repairofloose connectionsordefectsinhousewiring . 4 . Expensesformakingtheapplianceaccessibleforservicing , suchasremovaloftrim , cupboards , shelves , etc . , . yrotcafehtmorfdeppihssawtinehwecnailppaehtfotrapatonerahcihw 5 . Damagestofinishafterinstallation . 6 . Replacementoflightbulbsand / orfluorescenttubes ( onmodelswiththesefeatures ) . Thiswarrantydoesnotcoverthefollowing : EXCLUSIONS 1 . ALANDINCIDENTDAMAGEASPROPERTYALDAMAGESSUCHCONSEQUENTIALORINCIDENT ARRANTY . IMPLIEDWANY RITTENORTHISWBREACHOFANYEXPENSESRESULTINGFROM NOTE : Somestatesdonotallowtheexclusionorlimitationofincidentalorconsequentialdamages , sothis . uoyotylppatonyamnoisulcxeronoitatimil 2 . Servicecallswhichdonotinvolvemalfunctionordefectsinworkmanshipormaterial , orforappliancesnotin Theconsumershallpayforsuchservicecalls . ordinaryhouseholduse . 3 . DamagescausedbyservicesperformedbyservicersotherthanElectroluxHomeProductsNorthAmericaor itsauthorizedservicers ; useofpartsotherthangenuineElectroluxHomeProductsparts ; obtainedfrompersons . doGfostcaroylppusrewopetauqedani , esusim , esubasahcussesuaclanretxero ; srecivreshcusnahtrehto 4 . . denimretedylidaerebtonnacdnaderetlarodevomerneebevahtahtsrebmunlaireslanigirohtiwstcudorP ehtsehsilbatsellibehtnoetadehT . drocertnemyapetairporpparehtoemosro , pilsyreviled , elasfollibruoypeeK I F Y O U N E E D llapeekdnaniatboottseretnitsebruoynisiti , demrofrepsiecivresfI . deriuqerebecivresdluohsdoirepytnarraw E C I V R E S Youmayalsohaveotherrightsthatvaryfromstateto Thiswrittenwarrantygivesyouspecificlegalrights . receipts . : stcudorPemoHxulortcelEgnitcatnocybdeniatboebtsumytnarrawsihtrednuecivreS . etats rcsedsasnoitacificepsroserutaeftcudorP . adanaCdna , ociRotreuP , . A . S . Uehtfosetats05ehtniseilppaylnoytnarrawsihT detartsullirodebi CetihWfonoisivida , aciremAhtroNstcudorPemoHxulortcelEybedameraseitnarrawllA . ecitontuohtiwegnahcottcejbusera detadilosno . cnIadanaCICWybdetnarrawsiecnailpparuoy , adanaCnI . cnIseirtsudnI 01 - U - RE - 02 ( Rev . 12 / 2000 ) Canada U S A 866 • 213 • 9397 8 0 0 • 9 4 4 • 9 0 4 4 ElectroluxHomeProductsNorthAmerica ElectroluxHomeProductsNorthAmerica 6150McLaughlinRoad 8 7 3 2 1 2 x o B . O . P Mississauga , Ontario 71903AG , atsuguA 2C4R5L 20
Page: 21

ATTENTION To Properly Install Your Refrigerator See � Installation � Section On Pages 4 - 5 OR To Reverse The Doors See � Door Removal & Reversal � Section On Pages 6 - 9 Before You Call Before calling for service , review this list . It may save you time and Common expense . This list includes common occurrences that are not the result of Occurrences defective workmanship or materials in this appliance . Ensure plug is tightly pushed into electrical outlet . • Check / replace fuse with a 15 amp time - delay fuse . Reset circuit • breaker . Refrigerator does not run . • The temperature control is turned to OFF . Refrigerator may be in defrost cycle . Wait 20 minutes and check again . • • Set freezer control to a warmer setting until freezer temperature is Freezer temperature too cold . satisfactory . Allow 24 hours for the temperature to stabilize . Refrigerator temperature is satisfactory . Refrigerator temperature too cold . Set refrigerator control to a warmer setting . Allow 24 hours for • Freezer temperature is temperature to stabilize . Then check freezer temperatures and adjust as needed . satisfactory . The cabinet is not level . • * Refrigerator is noisy or vibrates . Floor is weak . • Interior needs to be cleaned . • Odors in refrigerator . • Foods that produce odors should be covered or wrapped . Replace light bulb . • • Ensure plug is tightly pushed into electrical outlet . Cabinet light not working . Light switch may be stuck . Push in light switch , located on the • refrigerator control box , to release . Ensure the Wire Signal Arm is not in UP position . • • Ice maker should produce 4 to 5 pounds of ice in a 24 hour period . Automatic ice maker not working . Water supply is turned off . • ( some models ) Water pressure is too low . • • The freezer is not cold enough . * See Normal Operating Sounds and Sights section on page 17 . 21
Search in Refrigerator on ebay