Register / log-in to add to your Hammerwall Collection.
Manual Location
The Search Results for the Search Section to the left will appear here.
Page: 1
P / N 240400103 ( 0104 )
Page: 2
Welcome & Congratulations Congratulations on your purchase of a newrefrigerator ! We Questions ? here at Electrolux Home Products are very proud of our product and we are completly committed to providing you 1 - 800 - 944 - 9044 with the best service possible . Your satisfaction is our # 1 ( United States ) priority . Please read this Use & Care Manual very carefully . It contains 1 - 866 - 213 - 9397 valuable information on how to properly maintain your new ( Canada ) refrigerator . We know you � ll enjoy your newrefrigerator and Thank You Extend Your Warranty Protection for choosing our product . We hope you consider us for future purchases . With An PLEASE READ AND SAVE THESE INSTRUCTIONS Electrolux Service Contract This Use & Care Manual provides specific operating instructions for your model . Use your refrigerator only as instructed in this manual . These instructions are not meant L A C L 1 - 7 0 6 - 8 6 0 - 4 1 1 0 to cover every possible condition and situation that may To Enjoy These Benefits : occur . Common sense and caution must be practiced when installing , operating and maintaining any appliance . Please record your model and serial numbers below for • T o t a l f r e e d o m f r o m r e p a i r b i l l s o s future reference . This information is found on your serial ruoytesput’nowsriaperdetcepxenu plate located inside the refrigerator compartment . . t e g d u b NOTE : Use only soap and water to clean serial plate . • e c i v r e s e e r f - l l o t t n e i n e v n o c , t s a F i s j u s t . y a w a l l a c e n o h p a Model Number : • sr ia p er y ti l au q - po T byfactory - trained Serial Number : e x p e r t s . Purchase Date : • t n e m e c a l p e r e n i u n e g o t s s e c c a k c i u Q t r a p s ruoyderussatsernacuoyos r e p o r p e h t h t i w d e r i a p e r s i r o t a r e g i r f e r . s t n e n o p m o c Please attach sales receipt here for future reference . ehtniliamdnaetelpmocesaelP t c u d o r P RegistrationCard includedwithyour refrigerator . 2
Page: 3
Important Safety Instructions WARNING : Please Read All Instructions Before Using This Refrigerator . FOR YOUR SAFETY PROPER DISPOSAL OF YOUR REFRIGERATOR OR FREEZER � Donotstoreorusegasoline , orotherflammableliquids in the vicinity of this or any other appliance . Read pro - Risk of child entrapment duct labels for warnings regarding flammability and other Childentrapmentand hazards . suffocation are not problems of � Donotoperatetherefrigeratorinthepresenseof the past . Junked or abondoned explosive fumes . refrigerators or freezers are still � Avoidcontactwithanymovingpartsofautomaticice dangerous � even if they will sit maker . for � just a few days . � If you are � Removeallstablesfromthecarton . Staplescancause getting rid of your old refrigerator severe cuts , and also destroy finishes if they come in or freezer , please follow the contact with other appliances or furniture . instructions below to help prevent accidents . CHILD SAFETY Destroy or recycle the carton , plastic bags , and any exterior Before you throw away your old refrigerator / freezer : wrapping material immediately after the refrigerator is � Removedoors . unpacked . Children shouldNEVER use these items to play . � Leaveshelvesinplacesochildrenmaynoteasilyclimb Cartons covered with rugs , bedspreads , plastic sheets or inside . stretch wrap may become airtight chambers , and can � Haverefrigerantremovedbyaqualifiedservice quickly cause suffocation . technician . These Guidelines Must Be Followed To Ensure That Safety Mechanisms In This Refrigerator Will Operate Properly . ELECTRICALTIIONNFORMA NOTE : Turning the refrigerator temperature control to � The refrigerator must be plugged into its own � 0 � turns off the compressor , but does not disconnect dedicated 115 Volt , 60 Hz . , AC only electric outlet . electrical power to the light bulb or other electrical The power cord of the appliance is equipped with a three - prong grounding plug for your protection against components . electrical shock hazards . It must be plugged directly into a properly grounded three - prong receptacle . The receptacle must be installed in accordance with local codes and ordinances . Consult a qualified electrician . Do not use an extension cord or adapter plug . � Immediatelyrepairorreplaceanypowercordthat becomes frayed or damaged . � Neverunplugtherefrigeratorbypullingonthepower cord . Always grip the plug firmly , and pull straight out from the receptacle to prevent damaging the power cord . � Unplugtherefrigeratorbeforecleaningandbefore replacing a light bulb to avoid electrical shock . � Performancemaybeaffectedifthevoltagevariesby 10 % or more . Operating the refrigerator with insufficient power can damage the compressor . Such damage is not covered under your warranty . � Donotplugtheunitintoanoutletcontrolledbyawall switch or pull cord to prevent the refrigerator from being turned off accidentally . � AvoidconnectingrefrigeratortoaGroundFault Interruptor ( GFI ) circuit . 3
Page: 4
Installation This Use & Care Manual provides specific operating LEVELING instructions for your model . Use the refrigerator only as All four corners of your refrigerator must rest firmly on a instructed in this Use & Care Manual . Before starting the solid floor . Your refrigerator is equipped with adjustable front refrigerator , follow these important first steps . rollers to help level your unit . To Level Your Refrigerator : LOCATION 1 . Removetoegrille . � Chooseaplacethatisnearagroundedelectricaloutlet . Do Not use an extension cord or an adapter plug . � If possible , place the refrigerator out of direct sunlight and away from the range , dishwasher or other heat sources . � Therefrigeratormustbeinstalledonafloorthatislevel and strong enough to support a fully loaded refrigerator . � Considerwatersupplyavailabilityformodelsequipped with an automatic ice maker . INSTALLATION � Do Not install the refrigerator where the temperature will drop below 55 � F ( 13 � C ) or rise above 110 � F ( 43 � C ) . The compressor will not be able to maintain proper temperatures inside the refrigerator . Do Not block the toe grille on the lower front of your refrigerator . Sufficient air circulation is essential for the proper operation of your refrigerator . 2 . Useflat - bladescrewdriveror3 / 8 � socketwrench to adjust front rollers . Installation Clearances � Allowthefollowingclearancesforeaseofinstallation , NOTE : Raise the front of the refrigerator enough so the proper air circulation , and plumbing and electrical doors close freely when opened halfway . The refrigerator connections : should slope … � to ‰ � from front - to - back . Then level the refrigerator from side to side . Sides & Top - - - - - - - - - - - - - 3 / 8 � Back - - - - - - - - - - - - - - - - - - - - 1 � NOTE : If you see black coils / tubing on the back of your refrigerator ( air - cooled condenser ) leave 3 � clearance at top of refrigerator . DOOR OPENING NOTE : If your refrigerator is placed with the door hinge side against a wall , you may have to allow additional space so the door can be opened wider . Your refrigerator should be positioned to allow easy access to a counter when removing food . To make this possible , the direction in which the doors open can be reversed . See Door Removal & Reversal Instructionson page 6 . 4
Page: 5
Installation - Connecting Optional Ice Maker To Water Supply To avoid electric shock , which can cause death or severe personal injury , disconnect the refrigerator from electrical power before connecting a water supply line to the refrigerator . To Avoid Property Damage : � Copper tubing is recommended for the water supply line . Water supply tubing made of … � plastic is not recommended since it greatly increases the potential for water leaks . Manufacturer will not be responsible for any damage if plastic tubing is used for supply line . � DONOTinstallwatersupplytubinginareaswheretemperaturesfallbelowfreezing . � Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . IMPORTANT : Ensure that your water supply line connections comply with all local plumbing codes . Before Installing The Water Supply Line , You Will Need TM � Basic Tools : adjustable wrench , flat - blade screwdriver , and Phillips screwdriver � Accesstoahouseholdcoldwaterlinewithwaterpressurebetween20and120psi . � A water supply line made of … inch ( 6.4 mm ) OD , copper tubing . To determine the length of copper tubing needed , you will need to measure the distance from the ice maker inlet valve at the back of the refrigerator to your cold water pipe . Then add approximately 7 feet ( 2.1 meters ) , so the refrigerator can be moved out for cleaning ( as shown ) . � A shutoff valve to connect the water supply line to your household water system . DO NOT use a self - piercing type shutoff valve . � A compression nut and ferrule ( sleeve ) for connecting the water supply line to the ice maker inlet valve . NOTE : Water line kit number 5303917950 , available from your appliance dealer at additional cost , contains 25 feet ( 7.6 meters ) of … inch OD copper tubing , a saddle type shutoff valve ( nonpiercing ) , ( 2 ) … inch brass compression nuts , ( 2 ) ferrules / sleeves , and instructions for installing a water supply line . To Connect Water Supply Line To Ice Maker Inlet Valve 1 . Disconnectrefrigeratorfromelectricpowersource . 2 . Placeendofwatersupplylineintosinkorbucket . Turn ON water supply and flush supply line until water is clear . Turn OFF water supply at shut off valve . 3 . Unscrewplasticcapfromwatervalveinletanddiscardcap . 4 . Slidebrasscompressionnut , thenferrule ( sleeve ) ontowatersupplyline , as shown . 5 . Pushwatersupplylineintowatervalveinletasfarasitwillgo ( … inch ) . Slide ferrule ( sleeve ) into valve inlet and finger tighten compression nut onto valve . Tighten another half turn with a wrench ; DO NOT over tighten . 6 . Withsteelclampandscrew , secure water supply line to rear panel of refrigerator as shown . 7 . Coilexcesswatersupplyline ( about2 ‰ turns ) behindrefrigeratorasshown and arrange coils so they do not vibrate or wear against any other surface . 8 . Turn ON water supply at shutoff valve and tighten any connections that leak . 9 . Reconnectrefrigeratortoelectricalpowersource . 10 . To turn ice maker on , lower wire signal arm ( see ice maker front cover for ON / OFF position of arm ) . IMPORTANT : It takes approximately 24 hours for the ice maker to begin producing ice . Air in new plumbing lines may cause ice maker to cycle two or three times before making a full tray of ice . New plumbing may cause ice to be discolored or have poor flavor . Discard ice made during the first 24hours . 5
Page: 6
Door Removal and Reversal Instructions DOOR REMOVAL AND REVERSAL INSTRUCTIONS : NOTE : If you have stainless steel doors - - go to theRemoving Stainless Steel Doors and HandlesSection on page 9 . NOTE : The direction in which your refrigerator doors open ( door swing ) can be reversed , from left to right or right to left , by moving the door hinges from one side to the other . Reversing the door swing should be performed by a qualified person . IMPORTANT : Before you begin , turn the refrigerator temperature control to � 0 � and remove the electrical power cord from the wall outlet . Remove any food from door shelves . 1 . Removetoegrilleandtophingecover . 2 . Removetophingewith3 / 8 � hexdriverandliftfreezerdooroffof center hinge pin . Set door aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewand loosening two outside screws enough to allow hinge and shim to slide out . Tighten screws . 6 . Loosentwooutsidescrewsonoppositesideofrefrigerator , remove inside screw and install center hinge . 7 . Removebottomhingewith3 / 8 � hexdriver . Reinsert two outside screws in holes and tighten . Inside screw will go to opposite side in step 8 . 8 . Removetwooutsidescrewsonoppositesideofrefrigeratorandinstall bottom hinge . Insert and tighten screw saved from step 7 . 9 . Unscrewbottomhingepinusingadjustablewrench . Movehingepin to other hole in hinge and tighten with adjustable wrench . 10 . Reversedoorhandles ( seeinstructionsonnextpage ) . 11 . Movefreezerandrefrigeratordoorstopstooppositeside . Before starting screws , use an awl to puncture the foam . 12 . Positionrefrigeratordoorontobottomhingepinandscrewcenter hinge pin through center hinge into top of door . Close refrigerator door to help align hinge hole . 13 . Tightencenterhingepinwithadjustablewrench . 14 . Removecabinetandhingeholeplugsandmovetooppositeside . 15 . Lowerfreezerdoorontocenterhingepin . 16 . Closefreezer door . Have an assistant lift up on opposite side of door while tightening screws to install top hinge . 17 . Replacetoegrilleandtophingecover . 18 . Pluginelectricalpowercordandturnrefrigeratortemperaturecontrol to center position . Adjust setting as necessary . 6
Page: 7
Door Removal and Reversal Instructions ( continued ) NOTE : Some models have � pocket � handles , which are recessed into the sides of the door . On these models , only the hinges will need to be reversed . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Removeshorttrimpiecebyslidingtrimstraightupandoffofhandle bracket . 3 . Removescrew attaching top of handle to door . 4 . Magnetic Nameplate Models : Gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Gently peel off nameplate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Reinstallhandleonoppositeside , usingsameholeasnameplate . 2 . Attachhandletobottomofdoor . 3 . Slidetrimpiecestraightdownontohandlebracket . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Swingbottomofhandleawayfromthedoorandslidehandlestraightup and off of dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , usingthe same holes as nameplate . 4 . Magnetic Nameplate Models : Use putty knife to gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Use putty knife to gently peel off name plate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Startwithhandleoffset away from door . Place top of handle over dovetail button , swing handle into an upright position and pull downward , locking it into place . 2 . Secure bottom of handle with two screws removed earlier . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to bottom of freezer door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideoffreezerdoorandremovehandle . TO ATTACH FREEZER HANDLE : 1 . Securesideofhandletodoorandreplacebuttonplug . 2 . Secure handle to bottom of door . NOTE : To remove freezer handle , refer to figure 3 on page 9 . 7
Page: 8
Door Removal and Reversal Instructions ( continued ) TRIM REMOVAL ( FULL - LENGTH TRIM MODELS ONLY ) In some models , the refrigerator door has a full length trim piece which continues from the bottom of the handle to the bottom of the door . The top of the trim attaches to the handle bracket ( Figure 1 ) or fits around the base of the handle ( Figure 2 ) . An adhesive � trim lock � is positioned about halfway down . The bottom of the trim is held in place by either an adhesive trim lock , or a trim lock with two prongs inserted into a hole on the face of the door . TO REMOVE TRIM : 1 . Removetrimbygentlypullingtrimlockareas out and away from door . 2 . Whentrimisfree from door , slide the trim straight down and away from base of handle . NOTE : For models with short handle trim , remove by sliding trim straight down and off of handle bracket . TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) Figure 1 Style Handles 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Removescrew attaching bottom of handle to door . 3 . Removetwoholeplugsandhingepinplugontopofdoorandinstall on opposite side . Use Phillips head screwdriver to remove plastic Figure 1 screw plug from front of door and install on opposite side Figure 2 Style Handles 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Swingtopofhandleawayfromdoorandslidehandledownandoffof dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , moving hole plugs from corresponding holes to opposite side . TO ATTACH REFRIGERATOR HANDLE : Figure 1 Style Handles 1 . Securebottomofhandlewithscrews . 2 . Securetopofhandlewithscrews . Figure 2 Style Handles 1 . Startwithhandleoffset away from door . Place bottom of handle over dovetail button , swing handle into an upright position and pull upward , locking it into place . 2 . Securetopofhandlewithscrews . TO ATTACH TRIM : 1 . Slidebothtrimlocksoutoftrim . 2 . Insertnewadhesivetrimlockscontainedinyourliteraturepack . NOTE : Trim lock must be removed and installed by sliding over the two donut shaped areas . Figure 2 3 . Installtrimtohandlebyslidingunderbaseofhandle . Carefullyalign trim and press down at trim lock locations . 4 . Userubbingalcoholtoremoveanyadhesiveresiduefromoldtrim lock locations . 8
Page: 9
Door Removal and Reversal Instructions ( continued ) TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Removetwoscrews attaching handle to top of refrigerator door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideofrefrigeratordoorandremovehandle . 4 . Reversefreezerandrefrigeratorhandlesasshowninfigure3 . Refrigerator Door Without Trim TO ATTACH REFRIGERATOR HANDLE : 1 . Securesideofhandletodoorandreplaceplugbutton . 2 . Secure handle to top of door . Figure 3 - Handle Reversal REMOVING STAINLESS STEEL DOORS AND HANDLES Use care when using tools near surface of stainless steel doors to avoid scratching . To Remove Doors Stainless steel doors are not reversible . Follow these steps to remove doors . 1 . Removetoegrilleandtophingecover . 2 . Removetophingeandliftfreezerdooroffofcenterhingepin . Setdoor aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewandloosening two outside screws enough to allow hinge to slide out . 6 . Removebottomhinge . Reinserttwooutsidescrewsinholesandtighten . 7 . Reversesteps1 - 6toreinstalldoors To Remove Handles 1 . Firmlyholdfreezerhandlewhilelooseningsetscrewswith3 / 32 � allen Typical Handle wrench . Remove freezer handle . 2 . Repeatstep1forrefrigeratordoor . 9
Page: 10
Features At A Glance Features may vary according to model 10
Page: 11
Temperature Controls COOL DOWN PERIOD To ensure safe food storage , allow the refrigerator to operate with the doors closed for at least 8 to 12 hours before loading it with food . REFRIGERATOR & FREEZER CONTROLS NOTE : When first setting the controls or when changing a setting , wait 24 hours for the temperature to stabilize before making additional changes . TEMPERATURE ADJUSTMENT : E T O N r o t a r e g i r f e r e v o m , n o r o t a r e g i r f e r g n i n r u t t s r i f n e h W o t s l o r t n o c r e z e e r f d n a ▼ d e d n e m m o c e r e h t s i h c i h w . d e d e e n s a s l o r t n o c e h t t s u j d a , s r u o h 4 2 r e t f A . g n i t t e s l a i t i n i � Adjust temperature gradually : move the knob in small increments , allowing the temperature to stabilize . � Forcoldertemperatures , turntheknobtowardsCold . Freezer Control ( some models ) � Forwarmertemperatures , turntheknobtowardsWarm . Turning the refrigerator control will change temperatures in both compartments . For example , if the refrigerator control is turned to a colder setting , the freezer control may have to be adjusted to a warmer setting . Turning the freezer control will change only the freezer temperature . To maintain temperatures , a fan circulates air in the refrigerator and freezer compartments . For good circulation , do not block cold air vents with food items . Refrigerator Control ( some models ) IMPORTANT : Turning the refrigerator temp - erature control to � 0 � turns off the com - pressor , but does not disconnect the power to the light bulb and other electrical components . Refrigerator & Freezer Control ( some models ) T E M P E R A T U R E A D J U S T M E N T G U I D E T u r n R e f r i g e r a t o r C o n t r o l S l i g h t l y T o w a r d s C o l d . I f R e f r i g e r a t o r c o m p a r t m e n t I s T o o W a r m T u r n R e f r i g e r a t o r C o n t r o l S l i g h t l y T o w a r d s W a r m . I f R e f r i g e r a t o r c o m p a r t m e n t I s T o o C o l d T u r n F r e e z e r C o n t r o l S l i g h t l y T o w a r d s C o l d e r . I f F r e e z e r c o m p a r t m e n t I s T o o W a r m T u r n F r e e z e r C o n t r o l S l i g h t l y T o w a r d s W a r m e r . I f F r e e z e r c o m p a r t m e n t I s T o o C o l d T o T u r n R e f r i g e r a t o r O f f 0 . T u r n R e f r i g e r a t o r C o n t r o l T o 11
Page: 12
Looking Inside To avoid personal injury or property damage , handle tempered glass shelves carefully . Shelves may break suddenly if nicked , scratched , or exposed to sudden temperature change . SHELF ADJUSTMENT Refrigerator shelves are easily adjusted to suit individual needs . Before adjusting the shelves , remove all food . To adjust sliding shelves : 1 Remove shelf by pulling forward to stop position . 2 Lift front edge up and pull out . Replace the shelf on any pair of rails by reversing this procedure . Sliding Wire Shelf To adjust cantilever shelves : NOTE : Cantilever shelves are supported at the back of the refrigerator . Cantilever shelves are available in either glass or wire . 1 Lift front edge up . 2 Pull shelf out . Replace the shelf by inserting the hooks at rear of the shelf into the wall bracket . Lower the shelf into the desired slots and lock into position . TM SpillSafe glass shelves ( some models ) catch and hold accidental spills . In TM some models , the SpillSafe shelves slide out for easy access to food and Sliding Glass Shelf for fast cleaning . The shelves slide out independently of the cantilever brackets . Just pull the front of the shelf forward . The shelf can be extended as far as the stopper will allow but it is not removable from the cantilever bracket . Full Width Cantilever Glass Shelf Cantilever Glass Shelf - Fixed and Sliding 12
Page: 13
Looking Inside ( continued ) DOOR STORAGE TALL BOTTLE RETAINER ( SOME MODELS ) Door bins , shelves , and racks are provided for convenient The Tall Bottle Retainer keeps tall containers in the bin from storage of jars , bottles , and cans . Frequently used items falling forward when opening or closing the refrigerator door . can be quickly selected . To install , hold the retainer at the top , and slide it over the outside wall of the bin , as shown in the diagram . The Tall Some models have door racks or bins that can Bottle Retainer works best with a Bin Snugger . accommodate gallon - sized plastic drink containers and economy - sized jars and containers . Some racks are adjustable for maximum storage capacity . The dairy compartment , which is warmer than the general food storage section , is intended for short term storage of cheese , spreads , or butter . Tall Bottle Retainer ( left ) and Bin Snugger ( right ) SPECIAL ITEM RACK ( SOME MODELS ) The innovative design of the Special Item Rack allows you to store a six - pack of 12 ounce drink cans , a bottle of wine , a two - liter soft drink bottle , or a carton of eggs . The Special Item Rack mounts on the left side of your refrigerator . To install , just slide the Special Item Rack onto any shelf as Door Rack shown in the drawing . ADJUSTABLE DOOR BINS Some models have adjustable door bins that can be moved to suit individual needs . To move door bins 1 . Lift bin straight up . 2 . Remove bin . 3 . Place bin in desired position . 4 . Lower bin onto supports until locked in place . Special Item Rack Adjustable Door Bin 13
Page: 14
Looking Inside - ( continued ) CRISPERS ( SOME MODELS ) DELI DRAWER ( SOME MODELS ) The crispers , located under the bottom refrigerator shelf , Some models are equipped with a Deli Drawer for storage are designed for storing fruits , vegetables , and other fresh of luncheon meats , spreads , cheeses , and other deli items . produce . Wash items in clear water and remove excess water before placing them in the crispers . Items with strong odors or high moisture content should be wrapped before storing . Deli Drawer WINE RACK ( SOME MODELS ) The Wine Rack stores bottles of wine , or single two - liter Crisper Drawer plastic bottles of juice or soda pop . To install , slide the Wine Rack onto the shelf with the curve facing in . To remove , slide the Wine Rack out . Install on either side of shelf . HUMIDITY CONTROL ( SOME MODELS ) The Humidity Control , present on some models with crisper drawers , allows you to adjust the humidity within the crisper . This can extend the life of fresh vegetables that keep best in high humidity . NOTE : Leafy vegetables keep best when stored with the Humidity Control set on High Humidity , or in a drawer without a Humidity Control . This keeps incoming air to a minimum and maintains maximum moisture content . Wine Rack Crisper Humidity Control 14
Page: 15
Ice Service If your refrigerator has an automatic ice maker , it will provide a sufficient supply of ice for normal use . During the initial startup of your refrigerator , however , no ice will be produced during the first 24 hours of operation . Automatic ice makers are also optional accessories that may be installed in most models at any time . Call your local dealer for information . TURNING YOUR ICE MAKER ON After the plumbing connections have been completed , the water supply valve must be opened . Place the ice container under the ice maker , pushing it as far back as possible . Lower the wire signal arm to its � down � or ON position . New plumbing connections may cause the first production of ice cubes to be discolored or have an odd flavor . These first cubes should be discarded until the cubes produced are free of discoloration and taste . TURNING YOUR ICE MAKER OFF To stop the ice maker , lift the wire signal arm until it clicks and locks in the Ice Maker � up � or OFF position . The ice maker also turns off automatically when the ice container is full . If your model has an adjustable freezer shelf , place the shelf in the lower position , so that the wire signal arm will hit the ice when the container is full . Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . ICE MAKER TIPS � Icecubesstored too long may develop an odd flavor . Empty the ice container and ensure that the wire signal arm is in its � down � or ON position . The ice maker will then produce more ice . � Occasionallyshaketheicecontainertokeepiceseparated . � Keepthewiresignalarminits � up � orOFFpositionuntiltherefrigeratorisconnectedtothewatersupplyorwhenever the water supply is turned off . � Thefollowingsoundsarenormalwhentheicemakerisoperating : � Motorrunning � Icelooseningfromtray � Ice dropping into ice container � Runningwater � Watervalveopeningorclosing NOTE : For more information on these operations , seeNormal Operating Sounds and Sightssection on page 17 . Do Not place the ice container in your dishwasher . � Wash the ice container in warm water with mild detergent . Rinse well and dry . � Stoptheicemakerwhencleaningthefreezerandduringvacations . � Iftheicemakerwillbeturnedoffforalongperiodoftime , turnthewatersupplyvalvetotheclosedposition . 15
Page: 16
Food Storage & Energy Saving Ideas FOOD STORAGE IDEAS Fresh Food Storage � Thefresh food compartment should be kept between 34 � F and 40 � F with an optimum temperature of 37 � F . � Avoidovercrowdingtherefrigeratorshelves . Thisreducesthecirculationofairaroundthefoodandresultsinuneven cooling . Fruits and Vegetables � Storageinthecrisperdrawerstrapsmoisturetohelppreservethefruitandvegetablequalityforlongertimeperiods . Meat � Rawmeatandpoultryshouldbewrappedsecurelysoleakageandcontaminationofotherfoodsorsurfacesdoesnot occur . Frozen Food Storage � Thefreezer compartment should be kept at 0 � F or lower . � A freezer operates most efficiently when it is at least 2 / 3 full . Packaging Foods for Freezing � To minimize dehydration and quality deterioration , use aluminum foil , freezer wrap , freezer bags or airtight containers . Force as much air out of the packages as possible and seal them tightly . Trapped air can cause food to dry out , change color , and develop an off - flavor ( freezer burn ) . � Wrapfreshmeatsandpoultrywithsuitablefreezerwrappriortofreezing . � Donotrefreezemeatthathascompletelythawed . Loading the Freezer � Avoid adding too much warm food to the freezer at one time . This overloads the freezer , slows the rate of freezing , and can raise the temperature of frozen foods . � Leaveaspacebetweenthepackages , socoldaircancirculatefreely , allowing food to freeze as quickly as possible . � Avoidstoringhard - to - freezefoodssuchasicecreamandorangejuiceonthefreezerdoorshelves . Thesefoodsare best stored in the freezer interior where the temperature varies less . ENERGY SAVING IDEAS � Locatetherefrigeratorinthecoolestpartoftheroom , outofdirectsunlight , and away from heating ducts or registers . Do not place the refrigerator next to heat - producing appliances such as a range , oven , or dishwasher . If this is not possible , a section of cabinetry or an added layer of insulation between the two appliances will help the refrigerator operate more efficiently . � Leveltherefrigerator so that the doors close tightly . � RefertothisUse & CareManualforthesuggestedtemperaturecontrol settings . � Periodiccleaningofthecondenserwillhelptherefrigeratorrunmore efficiently . See the Care and Cleaning Chart on page 18 . � Donotovercrowdtherefrigeratororblockcoldairvents . Doingsocauses the refrigerator to run longer and use more energy . � Coverfoodsandwipecontainersdrybeforeplacingtheminthe refrigerator . This cuts down on moisture build - up inside the unit . � Organizetherefrigeratortoreducedooropenings . Removeasmany items as needed at one time and close the door as soon as possible . 16
Page: 17
Normal Operating Sounds & Sights H E A R Y Y O U M A A N D I N G T H E S O U N D S U N D E R S T A . Evaporator The flow of refrigerant through the evaporator may Your new high - efficiency refrigerator may make unfamiliar create a boiling or gurgling sound . sounds . Don � t be alarmed , these are all normal sounds . Hard surfaces , such as vinyl or wood floors , walls , and B . Evaporator Fan kitchen cabinets may make sounds more noticeable . Listed You may hear air being forced through the refrigerator below are descriptions of some of the most common sounds by the evaporator fan . you may hear , and what is causing them . C . Defrost Heater NOTE : Rigid foam insulation is very energy efficient , During defrost cycles , water dripping onto the defrost but is not a sound insulator . heater may cause a hissing or sizzling sound . After defrosting , a popping sound may occur . IMPORTANT : During the automatic defrost cycle , you may notice a red glow in the vents on the back wall of your freezer compartment . This is normal during the defrost cycle . D . Automatic Ice Maker If your refrigerator is equipped with an automatic ice maker , you will hear ice cubes falling into the ice bin . E . Cold Control & Defrost Timer These parts can produce a snapping or clicking sound when turning the refrigerator on and off . The timer also produces sounds similar to an electric clock . F . Condenser Fan If condenser coils are located underneath your refrigerator as shown in the drawing at the left , you have a condenser fan . You may hear air being forced through the condenser by the condenser fan . G . Compressor Modern , high - efficiency compressors operate much faster than older models . The compressor may have a high - pitched hum or pulsating sound . H . Water Valve If your refrigerator is equipped with an automatic ice maker , you will hear a buzzing sound as the water valve opens to fill the ice maker during each cycle . I . Drain Pan ( Nonremovable ) You may hear water running into the drain pan during the defrost cycle . The drain pan will be located on top of the compressor for air - cooled condensers ( black coils on back of refrigerator ) . J . Condenser Coils ( Fan - cooled models only ) 17
Page: 18
Care & Cleaning Keep your refrigerator and freezer clean to prevent odor build - up . Wipe up any spills immediately and clean both sections at least twice a year . Never use metallic scouring pads , brushes , abrasive cleaners or strong alkaline solutions on any surface . Do not wash any removable parts in a dishwasher . Always unplug the electrical power cord from the wall outlet before cleaning . � When moving the refrigerator , pull straight out . Do not shift the refrigerator from side to side as this may tear or gouge the floor covering . If the refrigerator has an automatic ice maker , be careful not to move the refrigerator beyond the plumbing connections . � Dampobjectssticktocoldmetalsurfaces . Donottouchrefrigeratedsurfaceswithwetordamphands . � To avoid damage and help the refrigerator run as efficiently as possible , clean the condenser periodically . NOTES : � Turning the refrigerator temperature control to 0 � � turns off the compressor , but does not disconnect electrical power to the light bulb or other electrical components . � Donotuserazorbladesorothersharpinstrumentswhichcanscratchtheappliancesurfacewhenremoving adhesive labels . Any glue left from tape or labels can be removed with a mixture of warm water and mild detergent , or , touch the glue residue with the sticky side of tape you have already removed . Do not remove the serial plate . Care & Cleaning Chart Part What To Use Tips and Precautions Interior / Door Use 2 tablespoons of baking soda in 1 quart of warm water . Be sure to Soap and water • g excess water out of sponge or cloth before cleaning around wrin Liner Baking soda and water • controls , light bulb or any electrical part . Door Gaskets Wipe gaskets with a clean soft cloth . Soap and water • Soap and water • Drawers / Bins Do not wash any removable items ( bins , drawers , etc . ) in dishwasher . Allow glass to warm to room temperature before immersing in warm Soap and water • Glass Shelves water . Glass cleaner • Mild liquid sprays • Soap and water • Vacuum dust from front of toe grille . Remove toe grille ( See illustration on Toe Grille page 4 ) . Vacuum backside and wipe with sudsy cloth or sponge . Rinse Mild liquid sprays • and dry . Vacuumattachment • Soap and water • Exterior and Do not use commercial household cleaners , ammonia , or alcohol to clean Handles handles . Exterior and Soap and water • Clean stainless steel front and handles with soapy water . Use ammonia Handles on stubborn spots . Use a non - abrasive stainless steel cleaner . These Ammonia • ( Stainless cleaners can be purchased at most home improvement or major Stainless Steel • Steel Models department stores . Cleaners Only ) No need to clean unless operating refrigerator under particularly dusty or Condenser Cleaning • Condenser greasy conditions , or if there is significant pet traffic in your home . If Brush is available from Coils cleaning is necessary , remove toe grille and use extended vacuum your dealer . ( Fan - cooled attachment and condenser cleaning brush to remove dust build - up from VacuumCleaner • models only ) c o n d e n e s r c o s l i s ( e e t i e m “ J � i n l i u l s r t t a o i n o n p a g e 1 7 f o r o l c t a o i n . ) Condenser U s e h t e d u s n i t g o t o l t a a t c h m e n t o n y o u r v c a u u m o t e r m o v e d s u t b u l i d u - p V a c u u m C l a e n e r • Coils o n h t e c o n d n e s e r c i o s l ( b a l k c u t b e s a n d w r i e s ) a t a t c e h d o t t h e b c a k f o a i - r ( Air - cooled c o o e l d e r r f g i e a r t o s r o n y l . models only ) S o m e m o d e s l h a v e d e r s f o t w a e t r p a n l c o a e t d n o o t p o f c o m p r s e s o r a t S o a p a n d w a e t r • Defrost Water b o t o t m e r a r o f e r r f g i e a r t o r ( s e e l l i s u t a r i t o n o n n e x t p a g e . ) W p i e w a e t r p a n Pan w i h t d a m p c o l h t . N O T E : T h e d e r s f o t w a e t r p a n s i N O T r e m o v b a l e . 18
Page: 19
Care & Cleaning ( continued ) NEVER CLEAN CONDENSER ( SOME MODELS ) Avoid cuts when replacing light bulbs , , r e s n e d n o c n a e l C r e v e N a h t i w d e p p i u q e s i r o t a r e g i r f e r r u o y f I wear gloves . g n i t a r e p o l a m r o n r e d n u r e s n e d n o c e h t n a e l c o t d e e n o n s ’ e r e h t c o n d i t i o n s . I f t h e r e f r i g e r a t o r i s o p e r a t e d u n d e r p a r t i c u l a r l y REPLACING THE FREEZER LIGHT BULB c i f f a r t t e p t n a c i f i n g i s s i e r e h t f i r o , s n o i t i d n o c y s a e r g r o y t s u d ( SOME MODELS ) i n y o u r h o m e , i t m a y b e n e c e s s a r y t o p e r i o d i c a l l y c l e a n t h e 1 . Unplugrefrigerator . f i c i e n c y . c o n d e n s e r f o r m a x i m u m e f 2 . Wear gloves as protection against possible broken glass . 3 . Unsnaplightshieldasshown . 4 . Unscrewandreplaceoldbulbwithanappliancebulb of the same wattage . 5 . Replacelightshield . 6 . Remembertoplugtherefrigeratorbackin . Defrost Water Pan ( some models ) Vacation and Moving Tips Leave refrigerator operating during vacations of 3 weeks or less . • Short • Use all perishable items from refrigerator compartment . Vacations • Turn automatic ice maker off , even if you will only be gone for a few days . • Remove all food and ice if you will be gone one month or more . Turn controls to “ � 0 and disconnect power . • Turn off automatic ice maker and turn water supply valve to closed position . • Long • Clean interior thoroughly . Vacations Leave both doors open to prevent odors and mold build - up . Block doors open if • necessary . • Remove all food and ice . • If using handcart , load from side . o n i M v g Adjust rollers all the way up to protect them during sliding or moving . • Pad cabinet to avoid scratching surface . • 19
Page: 20
n o i t a m r o f n I y t n a r r a W Y T N A R R A W R O T A R E G I R F E R ytnarrawsihtybdetcetorpsirotaregirferruoY WARRANTY THROUGH OUR AUTHORIZED SERVICERS , THE CONSUMER WILL BE RESPONSIBLE FOR : PERIOD WE WILL : One year from original Pay all costs for repairing or replacing any parts of this Costs of service calls that are listed under NORMAL FULL ONE - YEAR purchase date appliance which prove to be defective in materials or RESPONSIBILITIES OF THE CONSUMER . * WARRANTY workmanship . Excludes original and replacement Ice & Water filter cartridges ( if equipped ) . Original and replacement cartridges are warranted for 30 days ( parts only ) . ND TH Second through fifth Repair or replace any parts in the cabinet liner or Costs for pick up and delivery of the appliance required because LIMITED 2 - 5 years from original Sealed Refrigeration System ( compressor , condenser , of service . Costs for labor , parts and transportation other than YEAR WARRANTY purchase date evaporator , drier and tubing ) which prove to be with respect to the cabinet liner or Sealed Refrigeration System . ( Cabinet Liner and defective in materials or workmanship . Sealed System ) Time periods listed All of the provisions of the full warranties above and rf o s s to c y n a d n a e m o h h'te i on cait n lh e ct ve a r t set h f os t s o C LIMITED above . the exclusions listed below apply . f o e s u c ae b d e ri u q e r c e n il p a a p e h tf o y r viel e d d n a u p cik p WARRANTY . v c i e r e s ( Applicable to the State of Alaska ) irtsudnIdetadilosnoCetihWfonoisivida , aciremAhtroNstcudorPemoHxulortcelEybdetnarrawsiecnailpparuoy , . A . S . UehtnI eW . cnIse rednu strap dna ecivres rof snoitagilbo ruO . ytnarraw siht rednu snoitagilbo ruo fo yna ot dda ro egnahc ot nosrep on ezirohtua tsum ytnarraw siht y b d e t n a r r a w s i e c n a i l p p a r u o y , a d a n a C n I . r e c i v r e s a c i r e m A h t r o N s t c u d o r P e m o H x u l o r t c e l E d e z i r o h t u a n a r o s u y b d e m r o f r e p e b . c n I a d a n a C I C W ehtrofelbisnopsersiremusnocehtdna , esudlohesuohyranidronistcudorpotylnoseilppaytnarrawsihTitemslistedbelow : * NORMAL RESPONSIBILITIES OFTHECONSUMER 1 . Properuseoftheapplianceinaccordancewithinstructionsprovidedwiththeproduct . 2 . Properinstallationbyanauthorizedservicerinaccordancewithinstructionsprovidedwiththeapplianceandin accordancewithalllocalplumbing , electricaland / orgascodes . 3 . Properconnectiontoagroundedpowersupplyofsufficientvoltage , replacementofblownfuses , repairofloose connectionsordefectsinhousewiring . 4 . Expensesformakingtheapplianceaccessibleforservicing , suchasremovaloftrim , cupboards , shelves , etc . , . yrotcafehtmorfdeppihssawtinehwecnailppaehtfotrapatonerahcihw 5 . Damagestofinishafterinstallation . 6 . Replacementoflightbulbsand / orfluorescenttubes ( onmodelswiththesefeatures ) . Thiswarrantydoesnotcoverthefollowing : EXCLUSIONS 1 . ALANDINCIDENTDAMAGEASPROPERTYALDAMAGESSUCHCONSEQUENTIALORINCIDENT ARRANTY . IMPLIEDWANY RITTENORTHISWBREACHOFANYEXPENSESRESULTINGFROM NOTE : Somestatesdonotallowtheexclusionorlimitationofincidentalorconsequentialdamages , sothis . uoyotylppatonyamnoisulcxeronoitatimil 2 . Servicecallswhichdonotinvolvemalfunctionordefectsinworkmanshipormaterial , orforappliancesnotin Theconsumershallpayforsuchservicecalls . ordinaryhouseholduse . 3 . DamagescausedbyservicesperformedbyservicersotherthanElectroluxHomeProductsNorthAmericaor itsauthorizedservicers ; useofpartsotherthangenuineElectroluxHomeProductsparts ; obtainedfrompersons . doGfostcaroylppusrewopetauqedani , esusim , esubasahcussesuaclanretxero ; srecivreshcusnahtrehto 4 . . denimretedylidaerebtonnacdnaderetlarodevomerneebevahtahtsrebmunlaireslanigirohtiwstcudorP ehtsehsilbatsellibehtnoetadehT . drocertnemyapetairporpparehtoemosro , pilsyreviled , elasfollibruoypeeK I F Y O U N E E D llapeekdnaniatboottseretnitsebruoynisiti , demrofrepsiecivresfI . deriuqerebecivresdluohsdoirepytnarraw E C I V R E S Youmayalsohaveotherrightsthatvaryfromstateto Thiswrittenwarrantygivesyouspecificlegalrights . receipts . : stcudorPemoHxulortcelEgnitcatnocybdeniatboebtsumytnarrawsihtrednuecivreS . etats rcsedsasnoitacificepsroserutaeftcudorP . adanaCdna , ociRotreuP , . A . S . Uehtfosetats05ehtniseilppaylnoytnarrawsihT detartsullirodebi CetihWfonoisivida , aciremAhtroNstcudorPemoHxulortcelEybedameraseitnarrawllA . ecitontuohtiwegnahcottcejbusera detadilosno . cnIadanaCICWybdetnarrawsiecnailpparuoy , adanaCnI . cnIseirtsudnI 01 - U - RE - 02 ( Rev . 12 / 2000 ) Canada U S A 866 • 213 • 9397 8 0 0 • 9 4 4 • 9 0 4 4 ElectroluxHomeProductsNorthAmerica ElectroluxHomeProductsNorthAmerica 6150McLaughlinRoad 8 7 3 2 1 2 x o B . O . P Mississauga , Ontario 71903AG , atsuguA 2C4R5L 20
Page: 21
ATTENTION To Properly Install Your Refrigerator See � Installation � Section On Pages 4 - 5 OR To Reverse The Doors See � Door Removal & Reversal � Section On Pages 6 - 9 Before You Call Before calling for service , review this list . It may save you time and Common expense . This list includes common occurrences that are not the result of Occurrences defective workmanship or materials in this appliance . Ensure plug is tightly pushed into electrical outlet . • Check / replace fuse with a 15 amp time - delay fuse . Reset circuit • breaker . Refrigerator does not run . • The temperature control is turned to OFF . Refrigerator may be in defrost cycle . Wait 20 minutes and check again . • • Set freezer control to a warmer setting until freezer temperature is Freezer temperature too cold . satisfactory . Allow 24 hours for the temperature to stabilize . Refrigerator temperature is satisfactory . Refrigerator temperature too cold . Set refrigerator control to a warmer setting . Allow 24 hours for • Freezer temperature is temperature to stabilize . Then check freezer temperatures and adjust as needed . satisfactory . The cabinet is not level . • * Refrigerator is noisy or vibrates . Floor is weak . • Interior needs to be cleaned . • Odors in refrigerator . • Foods that produce odors should be covered or wrapped . Replace light bulb . • • Ensure plug is tightly pushed into electrical outlet . Cabinet light not working . Light switch may be stuck . Push in light switch , located on the • refrigerator control box , to release . Ensure the Wire Signal Arm is not in UP position . • • Ice maker should produce 4 to 5 pounds of ice in a 24 hour period . Automatic ice maker not working . Water supply is turned off . • ( some models ) Water pressure is too low . • • The freezer is not cold enough . * See Normal Operating Sounds and Sights section on page 17 . 21