Home | Register Login | Wanted Manuals | MarketPlace | Members Area | Manuals Manufacturer Directory | UPC Lookup | Information Pages | Policy

Back To Frigidaire Refrigerator       Model: FRT21S6AWA Frigidaire Top Freezer Refrigerator Owners Manual
Regular Text Search or Search by Model Number

Register / log-in to add to your Hammerwall Collection.
Manual Location

Manuals For Same Model Number.
FRT21S6AWA Frigidaire Manuel d'utilisation et d'entretien ...
FRT21S6AWA Frigidaire Automatic Defrost top Freezer Refrig...
FRT21S6AWA Frigidaire Refrigerator Installation Guide...
FRT21S6AWA Frigidaire Top Freezer Refrigerator Parts And D...

Other Model Numbers Referenced to The Same Manual.
FRT21S6AWP Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AWN Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AW9 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AQP Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AQN Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AQA Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21S6AQ9 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P6CSKB Frigidaire Top Freezer Refrigerator Owners Manu...
frt21p6cska Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P6CSBB Frigidaire Top Freezer Refrigerator Owners Manu...
frt21p6csba Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P5AW1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21P5AQ1 Frigidaire Top Freezer Refrigerator Owners Manu...
frt21p5ab1 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21LR8DSN Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21LR8DS9 Frigidaire Top Freezer Refrigerator Owners Manu...
frt21lr8ds5 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21LR8DS3 Frigidaire Top Freezer Refrigerator Owners Manu...
FRT21LR8DK9 Frigidaire Top Freezer Refrigerator Owners Manu...
frt21lr8dk5 Frigidaire Top Freezer Refrigerator Owners Manu...

Other Items that are in the Same Category.
Unknown Frigidaire Top Mount Refrigerators...
Frigidaire Side by Side Refrigerator Manual...
Frigidaire top Mount Refrigerator...
Frigidaire Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Top Mount Refrigerator...
Frigidaire Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Side by Side Refrigerator...
Frigidaire Refrigerator...

This is a partial text extraction from the pdf, to download the pdf, click the Manual tab. If you want to search this text, hold control and F, and type the word you are looking for.

Page: 1

P / N 240400112 ( 0505 )
Page: 2

Welcome & Congratulations Congratulations on your purchase of a new refrigerator ! We Questions ? here at Electrolux Home Products , Inc . are very proud of our product and we are completly committed to providing 1 - 800 - 944 - 9044 you with the best service possible . Your satisfaction is our ( United States ) # 1 priority . Please read this Use & Care Manual very carefully . It contains 1 - 866 - 213 - 9397 valuable information on how to properly maintain your new ( Canada ) refrigerator . We know you’ll enjoy your new refrigerator and Thank You Extend Your Warranty Protection for choosing our product . We hope you consider us for future purchases . With An PLEASE READ AND SAVE THESE INSTRUCTIONS Extended Service Contract This Use & Care Manual provides specific operating instructions for your model . Use your refrigerator only as instructed in this manual . These instructions are not meant CALL 1 - 800 - 944 - 9044 to cover every possible condition and situation that may To Enjoy These Benefits : occur . Common sense and caution must be practiced when installing , operating and maintaining any appliance . Please record your model and serial numbers below for • Total freedom from repair bills so future reference . This information is found on your serial unexpected repairs won’t upset your plate located inside the refrigerator compartment . budget . NOTE : Use only soap and water to clean serial plate . • Fast , convenient toll - free service is just a phone call away . Model Number : • Top - quality repairs by factory - trained Serial Number : experts . Purchase Date : • Quickaccesstogenuinereplacement parts so you can rest assured your refrigerator is repaired with the proper components . Please attach sales receipt here for future reference . Please complete and mail in the Product Registration Card included with your refrigerator . 2
Page: 3

Important Safety Instructions WARNING : Please Read All Instructions Before Using This Refrigerator . FOR YOUR SAFETY PROPER DISPOSAL OF YOUR REFRIGERATOR OR FREEZER • Donotstoreorusegasoline , orotherflammableliquids in the vicinity of this or any other appliance . Read pro - Risk of child entrapment duct labels for warnings regarding flammability and other Child entrapment and hazards . suffocation are not problems of • Donotoperatetherefrigeratorinthepresenseof the past . Junked or abondoned explosive fumes . refrigerators or freezers are still • Avoid contact with any moving parts of automatic ice dangerous – even if they will sit maker . for “ just a few days . ” If you are • Remove all staples from the carton . Staples can cause getting rid of your old refrigerator severe cuts , and also destroy finishes if they come in or freezer , please follow the contact with other appliances or furniture . instructions below to help prevent accidents . CHILD SAFETY Destroy or recycle the carton , plastic bags , and any exterior Before you throw away your old refrigerator / freezer : wrapping material immediately after the refrigerator is • Removedoors . unpacked . Children should NEVER use these items to play . • Leaveshelvesinplacesochildrenmaynoteasilyclimb Cartons covered with rugs , bedspreads , plastic sheets or inside . stretch wrap may become airtight chambers , and can quickly • Haverefrigerantremovedbyaqualifiedservice cause suffocation . technician . These Guidelines Must Be Followed To Ensure That Safety Mechanisms In This Refrigerator Will Operate Properly . ELECTRICAL INFORMATION IMPORTANT : Turning the Freezer and Fresh Food • The refrigerator must be plugged into its own Controls to “ 0 ” turns off the compressor and prevents dedicated 115 Volt , 60 Hz . , AC only electric outlet . your refrigerator from cooling , but does not disconnect The power cord of the appliance is equipped with a the power to the light bulb and other electrical three - prong grounding plug for your protection against components . To turn off power to your refrigerator you electrical shock hazards . It must be plugged directly must unplug the power cord from the wall outlet . into a properly grounded three - prong receptacle . The receptacle must be installed in accordance with local codes and ordinances . Consult a qualified electrician . Do not use an extension cord or adapter plug . • Ifthepowercordisdamaged , itshouldbereplacedbythe manufacturer , service technician or a qualified person to prevent any risk . • Neverunplugtherefrigeratorbypullingonthepower cord . Always grip the plug firmly , and pull straight out from the receptacle to prevent damaging the power cord . • Unplugtherefrigeratorbeforecleaningandbefore replacing a light bulb to avoid electrical shock . • Performance may be affected if the voltage varies by 10 % or more . Operating the refrigerator with insufficient power can damage the compressor . Such damage is not covered under your warranty . • Donotplugtheunitintoanoutletcontrolledbyawall switch or pull cord to prevent the refrigerator from being turned off accidentally . • Avoid connecting refrigerator to a Ground Fault Interruptor ( GFI ) circuit . 3
Page: 4

Installation This Use & Care Manual provides specific operating LEVELING instructions for your model . Use the refrigerator only as All four corners of your refrigerator must rest firmly on a instructed in this Use & Care Manual . Before starting the solid floor . Your refrigerator is equipped with adjustable front refrigerator , follow these important first steps . rollers or front leveling screws to help level your unit . To Level Your Refrigerator : LOCATION 1 . Removetoegrille . • Chooseaplacethatisnearagroundedelectricaloutlet . Do Not use an extension cord or an adapter plug . • Ifpossible , placetherefrigeratoroutofdirectsunlight and away from the range , dishwasher or other heat sources . • Therefrigeratormustbeinstalledonafloorthatislevel and strong enough to support a fully loaded refrigerator . • Considerwatersupplyavailabilityformodelsequipped with an automatic ice maker . INSTALLATION Do Not install the refrigerator where the temperature will drop below 55 ° F ( 13 ° C ) or rise above 110 ° F ( 43 ° C ) . The compressor will not be able to maintain 2 . Useflat - bladescrewdriveror3 / 8 ” socketwrench proper temperatures inside the refrigerator . to adjust front rollers . Use adjustable wrench to adjust Do Not block the toe grille on the leveling screws . lower front of your refrigerator . Sufficient air NOTE : Raise the front of the refrigerator enough so the circulation is essential for the proper operation of doors close freely when opened halfway . The refrigerator your refrigerator . should slope ¼ ” to ½ ” from front to back . Then level the Installation Clearances refrigerator from side to side . • Allowthefollowingclearancesforeaseofinstallation , proper air circulation , and plumbing and electrical connections : Sides & Top - - - - - - - - - - - - - - - 3 / 8 ” Back - - - - - - - - - - - - - - - - - - - - - - - - 1 ” NOTE : If you see black coils / tubing on the back of your refrigerator ( air - cooled condenser ) leave 3 ” clearance at top of refrigerator . DOOR OPENING NOTE : If your refrigerator is placed with the door hinge Adjustable Front Roller side against a wall , you may have to allow additional space so the door can be opened wider . Your refrigerator should be positioned to allow easy access to a counter when removing food . To make this possible , the direction in which the doors open can be reversed . See Door Removal & Reversal Instructions on page 6 . Raise Stationary Front Roller with Leveling Screw 4
Page: 5

Installation - Connecting Optional Ice Maker To Water Supply To avoid electric shock , which can cause death or severe personal injury , disconnect the refrigerator from electrical power before connecting a water supply line to the refrigerator . To Avoid Property Damage : • Copper tubing is recommended for the water supply line . Water supply tubing made of ¼ ” plastic is not recommended since it greatly increases the potential for water leaks . Manufacturer will not be responsible for any damage if plastic tubing is used for supply line . • DONOT install water supply tubing in areas where temperatures fall below freezing . • Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . IMPORTANT : Ensure that your water supply line connections comply with all local plumbing codes . Before Installing The Water Supply Line , You Will Need TM • Basic Tools : adjustable wrench , flat - blade screwdriver , and Phillips screwdriver • Accesstoahouseholdcoldwaterlinewithwaterpressurebetween30and120psi . • A water supply line made of ¼ inch ( 6.4 mm ) OD , copper tubing . To determine the length of copper tubing needed , you will need to measure the distance from the ice maker inlet valve at the back of the refrigerator to your cold water pipe . Then add approximately 7 feet ( 2.1 meters ) , so the refrigerator can be moved out for cleaning ( as shown ) . • A shutoff valve to connect the water supply line to your household water system . DO NOT use a self - piercing type shutoff valve . • A compression nut and ferrule ( sleeve ) for connecting the water supply line to the ice maker inlet valve . NOTE : Water line kit number 5303917950 , available from your appliance dealer at additional cost , contains 25 feet ( 7.6 meters ) of ¼ inch OD copper tubing , a saddle type shutoff valve ( nonpiercing ) , ( 2 ) ¼ inch brass compression nuts , ( 2 ) ferrules / sleeves , and instructions for installing a water supply line . To Connect Water Supply Line To Ice Maker Inlet Valve 1 . Disconnectrefrigeratorfromelectricpowersource . 2 . Placeendofwater supply line into sink or bucket . Turn ON water supply and flush supply line until water is clear . Turn OFF water supply at shut off valve . 3 . Unscrewplasticcapfromwatervalveinletanddiscardcap . 4 . Slidebrasscompressionnut , thenferrule ( sleeve ) ontowatersupplyline , as shown . 5 . Pushwatersupplylineintowatervalveinletasfarasitwillgo ( ¼ inch ) . Slide ferrule ( sleeve ) intovalveinletandfingertightencompressionnut onto valve . Tighten another half turn with a wrench ; DO NOT over tighten . 6 . Withsteelclampandscrew , secure water supply line to rear panel of refrigerator as shown . 7 . Coilexcesswatersupplyline ( about2 ½ turns ) behindrefrigeratorasshown and arrange coils so they do not vibrate or wear against any other surface . 8 . Turn ON water supply at shutoff valve and tighten any connections that leak . 9 . Reconnectrefrigeratortoelectricalpowersource . 10 . To turn ice maker on , lower wire signal arm ( see ice maker front cover for ON / OFF position of arm ) . IMPORTANT : It takes approximately 24 hours for the ice maker to begin producing ice . Air in new plumbing lines may cause ice maker to cycle two or three times before making a full tray of ice . New plumbing may cause ice to be discolored or have poor flavor . Discard ice made during the first 24 hours . 5
Page: 6

Door Removal and Reversal Instructions DOOR REMOVAL AND REVERSAL INSTRUCTIONS : NOTE : If you have stainless steel doors - - go to the Removing Stainless Steel Doors and Handles Section on page 9 . NOTE : The direction in which your refrigerator doors open ( door swing ) can be reversed , from left to right or right to left , by moving the door hinges from one side to the other . Reversing the door swing should be performed by a qualified person . IMPORTANT : Before you begin , turn the refrigerator temperature control to “ 0 ” and remove the electrical power cord from the wall outlet . Remove any food from door shelves . 1 . Remove toe grille and top hinge cover . 2 . Removetophingewith3 / 8 ” hexdriverandliftfreezerdooroffof center hinge pin . Set door aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewand loosening two outside screws enough to allow hinge and shim to slide out . Tighten screws . 6 . Loosentwo outside screws on opposite side of refrigerator , remove inside screw and install center hinge . 7 . Removetwoscrewsonbottomhingewith3 / 8 ” socketwrench . 8 . Installbottomhingeonoppositesidewiththetwoscrewsremoved from step 7 . 9 . Unscrewbottomhingepinusingadjustablewrench . Movehingepin to other hole in hinge and tighten with adjustable wrench . 10 . Reversedoorhandles ( seeinstructionsonnextpage ) . 11 . Movefreezerandrefrigeratordoorstopstooppositeside . Before starting screws , use an awl to puncture the foam . 12 . Position refrigerator door onto bottom hinge pin and screw center hinge pin through center hinge into top of door . Close refrigerator door to help align hinge hole . 13 . Tightencenterhingepinwithadjustablewrench . 14 . Removecabinetandhingeholeplugsandmovetooppositeside . 15 . Lowerfreezerdoorontocenterhingepin . 16 . Closefreezer door . Have an assistant lift up on opposite side of door while tightening screws to install top hinge . 17 . Replacetoegrille and top hinge cover . 18 . Pluginelectricalpowercordandturnrefrigeratortemperaturecontrol to center position . Adjust setting as necessary . 6
Page: 7

Door Removal and Reversal Instructions ( continued ) NOTE : Some models have “ pocket ” handles , which are recessed into the sides of the door . On these models , only the hinges will need to be reversed . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Remove two screws attaching handle to bottom of freezer door . 2 . Remove short trim piece by sliding trim straight up and off of handle bracket . 3 . Remove screw attaching top of handle to door . 4 . Magnetic Nameplate Models : Gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Gently peel off nameplate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Reinstallhandleonoppositeside , usingsameholeasnameplate . 2 . Attachhandletobottomofdoor . 3 . Slidetrimpiecestraightdownontohandlebracket . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Remove two screws attaching handle to bottom of freezer door . 2 . Swingbottomofhandleawayfromthedoorandslidehandlestraightup and off of dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , usingthe same holes as nameplate . 4 . Magnetic Nameplate Models : Use putty knife to gently pry magnetic nameplate frame from door . Remove nameplate from its frame , turn frame upside down and install in old handle holes . Insert magnetic nameplate into frame . Self - Adhesive Nameplate Models : Use putty knife to gently peel off name plate from door and reapply over old handle holes . TO ATTACH FREEZER HANDLE : 1 . Start with handle offset away from door . Place top of handle over dovetail button , swing handle into an upright position and pull downward , locking it into place . 2 . Securebottomofhandlewithtwoscrews removed earlier . TO REMOVE FREEZER HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Remove two screws attaching handle to bottom of freezer door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideoffreezerdoorandremovehandle . TO ATTACH FREEZER HANDLE : 1 . Securesideofhandletodoorandreplacebuttonplug . 2 . Securehandletobottomofdoor . NOTE : To remove freezer handle , refer to figure 3 on page 9 . 7
Page: 8

Door Removal and Reversal Instructions ( continued ) TRIM REMOVAL ( FULL - LENGTH TRIM MODELS ONLY ) In some models , the refrigerator door has a full length trim piece which continues from the bottom of the handle to the bottom of the door . The top of the trim attaches to the handle bracket ( Figure 1 ) or fits around the base of the handle ( Figure 2 ) . An adhesive “ trim lock ” is positioned about halfway down . The bottom of the trim is held in place by either an adhesive trim lock , or a trim lock with two prongs inserted into a hole on the face of the door . TO REMOVE TRIM : 1 . Remove trim by gently pulling trim lock areas out and away from door . 2 . Whentrim is free from door , slide the trim straight down and away from base of handle . NOTE : For models with short handle trim , remove by sliding trim straight down and off of handle bracket . TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) Figure 1 Style Handles 1 . Remove two screws attaching handle to top of refrigerator door . 2 . Remove screw attaching bottom of handle to door . 3 . Removetwoholeplugsandhingepinplugontopofdoorandinstall on opposite side . Use Phillips head screwdriver to remove plastic Figure 1 screw plug from front of door and install on opposite side Figure 2 Style Handles 1 . Remove two screws attaching handle to top of refrigerator door . 2 . Swingtopofhandleawayfromdoorandslidehandledownandoffof dovetail button . 3 . Removescrewanddovetailbuttonandinstallonotherside , moving hole plugs from corresponding holes to opposite side . TO ATTACH REFRIGERATOR HANDLE : Figure 1 Style Handles 1 . Securebottomofhandlewithscrews . 2 . Securetopofhandlewithscrews . Figure 2 Style Handles 1 . Start with handle offset away from door . Place bottom of handle over dovetail button , swing handle into an upright position and pull upward , locking it into place . 2 . Securetopofhandlewithscrews . TO ATTACH TRIM : 1 . Slidebothtrimlocksoutoftrim . 2 . Insert new adhesive trim locks contained in your literature pack . NOTE : Trim lock must be removed and installed by sliding over the two donut shaped areas . Figure 2 3 . Installtrimtohandlebyslidingunderbaseofhandle . Carefullyalign trim and press down at trim lock locations . 4 . Userubbingalcoholtoremoveanyadhesiveresiduefromoldtrim lock locations . 8
Page: 9

Door Removal and Reversal Instructions ( continued ) TO REMOVE REFRIGERATOR HANDLE : ( Handles may be easier to reverse while doors are off . ) 1 . Remove two screws attaching handle to top of refrigerator door . 2 . Removebuttonplugusingedgeofputtyknife . 3 . Removescrewonsideofrefrigeratordoorandremovehandle . 4 . Reversefreezerandrefrigeratorhandlesasshowninfigure3 . Refrigerator Door Without Trim TO ATTACH REFRIGERATOR HANDLE : 1 . Securesideofhandletodoorandreplaceplugbutton . 2 . Securehandletotopofdoor . Figure 3 - Handle Reversal REMOVING STAINLESS STEEL DOORS AND HANDLES Use care when using tools near surface of stainless steel doors to avoid scratching . To Remove Doors Stainless steel doors are not reversible . Follow these steps to remove doors . 1 . Remove toe grille and top hinge cover . 2 . Removetophingeandliftfreezerdooroffofcenterhingepin . Setdoor aside . 3 . Unscrewcenterhingepinusingadjustablewrenchandsavefor reassembly . Ensure plastic washer stays on hinge pin . 4 . Liftrefrigeratordooroffofbottomhingeandsetaside . 5 . Removecenterhingeandshimbyremovinginsidescrewandloosening two outside screws enough to allow hinge to slide out . 6 . Remove bottom hinge . Reinsert two outside screws in holes and tighten . 7 . Reversesteps1 - 6toreinstalldoors To Remove Handles 1 . Firmlyholdfreezerhandlewhilelooseningsetscrewswith3 / 32 ” allen Typical Handle wrench . Remove freezer handle . 2 . Repeatstep1for refrigerator door . 9
Page: 10

Features At A Glance Ice Tray Freezer Light Ice Maker Ice Bucket Fixed Door Bin Freezer Shelf Freezer Control Door Rack Refrigerator Control Dairy Door Deli Drawer Cover Tall Bottle Retainer Deli Drawer Half Shelf Snugger Wine Rack Door Bin Full Shelf Special Item Rack Fixed Door Bin Mid Level Light Door Rack Crisper Cover Crisper Drawers Toe Grille Features may vary according to model 10
Page: 11

Temperature Controls COOL DOWN PERIOD To ensure safe food storage , allow the refrigerator to operate with the doors closed for at least 8 to 12 hours before loading it with food . REFRIGERATOR & FREEZER CONTROLS NOTE : When changing control settings , wait 24 hours before making additional adjustments . TEMPERATURE ADJUSTMENT NOTE : When first turning refrigerator on , move refrigerator and freezer controls to which is the recommended initial setting . After 24 hours , adjust the controls as needed . • Adjust temperature gradually : move the knob in small increments , allowing the temperature to stabilize . • For colder temperatures , turn the knob towards Colder . • Forwarmertemperatures , turntheknobtowards Cold . Turning the refrigerator control will change temperatures in both Freezer Control ( some models ) compartments . For example , if the refrigerator control is turned to a colder setting , the freezer control may have to be adjusted to a warmer setting . Turning the freezer control will change only the freezer temperature . To maintain temperatures , a fan circulates air in the refrigerator and freezer compartments . For good circulation , do not block cold air vents with food items . Refrigerator Control ( some models ) * IMPORTANT : Turning the refrigerator temp - erature control to “ 0 ” turns off the com - pressor , but does not disconnect the power to the light bulb and other electrical components . To turn off power to your refrigerator , you must unplug the power cord from the wall outlet . Refrigerator & Freezer Control ( some models ) TEMPERATURE ADJUSTMENT GUIDE Turn Refrigerator Control Slightly Towards der . Col If Refrigerator compartment Is Too Warm Turn Refrigerator Control Slightly Towards Cold . If Refrigerator compartment Is Too Cold Turn Freezer Control Slightly Towards Colder . compartment Is Too Warm If Freezer r Control Slightly Towards Turn Freeze Cold . If Freezer compartment Is Too Cold * To Turn Refrigerator Off Turn Refrigerator Control To 0 . 11
Page: 12

Looking Inside To avoid personal injury or property damage , handle tempered glass shelves carefully . Shelves may break suddenly if nicked , scratched , or exposed to sudden temperature change . SHELF ADJUSTMENT Refrigerator shelves are easily adjusted to suit individual needs . Before adjusting the shelves , remove all food . To adjust sliding shelves : 1 Remove shelf by pulling forward to stop position . 2 Lift front edge up and pull out . Replace the shelf on any pair of rails by reversing this procedure . Sliding Wire Shelf To adjust cantilever shelves : NOTE : Cantilever shelves are supported at the back of the refrigerator . Cantilever shelves are available in either glass or wire . 1 Lift front edge up . 2 Pull shelf out . Replace the shelf by inserting the hooks at rear of the shelf into the wall bracket . Lower the shelf into the desired slots and lock into position . TM SpillSafe glass shelves ( some models ) catch and hold accidental spills . In TM some models , the SpillSafe shelves slide out for easy access to food and Sliding Glass Shelf for fast cleaning . The shelves slide out independently of the cantilever brackets . Just pull the front of the shelf forward . The shelf can be extended as far as the stopper will allow but it is not removable from the cantilever bracket . Full Width Cantilever Glass Shelf Cantilever Glass Shelf - Fixed and Sliding 12
Page: 13

Looking Inside ( continued ) DOOR STORAGE TALL BOTTLE RETAINER ( SOME MODELS ) Door bins , shelves , and racks are provided for convenient The Tall Bottle Retainer keeps tall containers in the bin from storage of jars , bottles , and cans . Frequently used items falling forward when opening or closing the refrigerator door . can be quickly selected . To install , hold the retainer at the top , and slide it over the outside wall of the bin , as shown in the diagram . The Tall Some models have door racks or bins that can accommodate Bottle Retainer works best with a Bin Snugger . gallon - sized plastic drink containers and economy - sized jars and containers . Some racks are adjustable for maximum storage capacity . The dairy compartment , which is warmer than the general food storage section , is intended for short term storage of cheese , spreads , or butter . Tall Bottle Retainer ( left ) and Bin Snugger ( right ) SPECIAL ITEM RACK ( SOME MODELS ) The innovative design of the Special Item Rack allows you to store a six - pack of 12 ounce drink cans , a bottle of wine , a two - liter soft drink bottle , or a carton of eggs . The Special Item Rack mounts on the left side of your refrigerator . To install , just slide the Special Item Rack onto any shelf as Door Rack shown in the drawing . ADJUSTABLE DOOR BINS Some models have adjustable door bins that can be moved to suit individual needs . To move door bins 1 . Lift bin straight up . 2 . Remove bin . 3 . Place bin in desired position . 4 . Lower bin onto supports until locked in place . Special Item Rack Adjustable Door Bin 13
Page: 14

Looking Inside - ( continued ) CRISPERS ( SOME MODELS ) DELI DRAWER ( SOME MODELS ) The crispers , located under the bottom refrigerator shelf , Some models are equipped with a Deli Drawer for storage of are designed for storing fruits , vegetables , and other fresh luncheon meats , spreads , cheeses , and other deli items . produce . Wash items in clear water and remove excess water before placing them in the crispers . Items with strong odors or high moisture content should be wrapped before storing . Deli Drawer WINE RACK ( SOME MODELS ) The Wine Rack stores bottles of wine , or single two - liter Crisper Drawer plastic bottles of juice or soda pop . To install , slide the Wine Rack onto the shelf with the curve facing in . To remove , slide the Wine Rack out . Install on either side of shelf . HUMIDITY CONTROL ( SOME MODELS ) The Humidity Control , present on some models with crisper drawers , allows you to adjust the humidity within the crisper . This can extend the life of fresh vegetables that keep best in high humidity . NOTE : Leafy vegetables keep best when stored with the Humidity Control set on High Humidity , or in a drawer without a Humidity Control . This keeps incoming air to a minimum and maintains maximum moisture content . Wine Rack Crisper Humidity Control 14
Page: 15

Ice Service If your refrigerator has an automatic ice maker , it will provide a sufficient supply of ice for normal use . During the initial startup of your refrigerator , however , no ice will be produced during the first 24 hours of operation . Automatic ice makers are also optional accessories that may be installed in most models at any time . Call your local dealer for information . The ice maker produces 2 to 5 pounds of ice every 24 hours depending on usage conditions . Ice is produced at a rate of 8 cubes every 80 to 160 minutes . TURNING YOUR ICE MAKER ON After the plumbing connections have been completed , the water supply valve must be opened . Place the ice container under the ice maker , pushing it as far back as possible . Lower the wire signal arm to its “ down ” or ON position . New plumbing connections may cause the first production of ice cubes to be discolored or have an odd flavor . These first cubes should be discarded until the cubes produced are free of discoloration and taste . Ice Maker TURNING YOUR ICE MAKER OFF To stop the ice maker , lift the wire signal arm until it clicks and locks in the “ up ” or OFF position . The ice maker also turns off automatically when the ice container is full . If your model has an adjustable freezer shelf , place the shelf in the lower position , so that the wire signal arm will hit the ice when the container is full . IMPORTANT : Your ice maker is shipped with the wire signal arm in the ON position . To ensure proper function of your ice maker , hook up water supply immediately or turn ice maker OFF by lifting the wire signal arm until it clicks and locks in the UP position . Chemicals from a malfunctioning softener can damage the ice maker . If the ice maker is connected to soft water , ensure that the softener is maintained and working properly . ICE MAKER TIPS • Icecubesstoredtoolongmay develop an odd flavor . Empty the ice container and ensure that the wire signal arm is in its “ down ” or ON position . The ice maker will then produce more ice . • Occasionallyshaketheicecontainertokeepiceseparated . • Keep the wire signal arm in its “ up ” or OFF position until the refrigerator is connected to the water supply or whenever the water supply is turned off . • Thefollowingsoundsarenormalwhentheicemakerisoperating : • Motorrunning • Icelooseningfromtray • Icedroppingintoicecontainer • Runningwater • Water valve opening or closing NOTE : For more information on these operations , see Normal Operating Sounds and Sights section on page 17 . Do Not place the ice container in your dishwasher . • Wash the ice container in warm water with mild detergent . Rinse well and dry . • Stoptheicemakerwhencleaningthefreezerandduringvacations . • Iftheicemakerwillbeturnedoffforalongperiodoftime , turnthewatersupplyvalvetotheclosedposition . 15
Page: 16

Food Storage & Energy Saving Ideas FOOD STORAGE IDEAS Fresh Food Storage • Thefreshfood compartment should be kept between 34 ° F and 40 ° F with an optimum temperature of 37 ° F . • Avoid overcrowding the refrigerator shelves . This reduces the circulation of air around the food and results in uneven cooling . Fruits and Vegetables • Storageinthecrisperdrawerstrapsmoisturetohelppreservethefruitandvegetablequalityforlongertimeperiods . Meat • Rawmeatandpoultryshouldbewrappedsecurelysoleakageandcontaminationofotherfoodsorsurfacesdoesnot occur . Frozen Food Storage • Thefreezer compartment should be kept at 0 ° F or lower . • A freezer operates most efficiently when it is at least 2 / 3 full . Packaging Foods for Freezing • To minimize dehydration and quality deterioration , use aluminum foil , freezer wrap , freezer bags or airtight containers . Force as much air out of the packages as possible and seal them tightly . Trapped air can cause food to dry out , change color , and develop an off - flavor ( freezer burn ) . • Wrapfreshmeatsandpoultrywithsuitablefreezerwrappriortofreezing . • Donotrefreezemeatthathascompletelythawed . Loading the Freezer • Avoid adding too much warm food to the freezer at one time . This overloads the freezer , slows the rate of freezing , and can raise the temperature of frozen foods . • Leave a space between the packages , so cold air can circulate freely , allowing food to freeze as quickly as possible . • Avoid storing hard - to - freeze foods such as ice cream and orange juice on the freezer door shelves . These foods are best stored in the freezer interior where the temperature varies less . ENERGY SAVING IDEAS • Locatetherefrigerator in the coolest part of the room , out of direct sunlight , and away from heating ducts or registers . Do not place the refrigerator next to heat - producing appliances such as a range , oven , or dishwasher . If this is not possible , a section of cabinetry or an added layer of insulation between the two appliances will help the refrigerator operate more efficiently . • Level the refrigerator so that the doors close tightly . • RefertothisUse & CareManualforthesuggestedtemperaturecontrol settings . • Periodic cleaning of the condenser will help the refrigerator run more efficiently . See the Care and Cleaning Chart on page 18 . • Donotovercrowdtherefrigeratororblockcoldairvents . Doingsocauses the refrigerator to run longer and use more energy . • Coverfoodsandwipecontainersdrybeforeplacingtheminthe refrigerator . This cuts down on moisture build - up inside the unit . • Organizetherefrigeratortoreducedooropenings . Removeasmany items as needed at one time and close the door as soon as possible . 16
Page: 17

Normal Operating Sounds & Sights UNDERSTANDING THE SOUNDS YOU MAY HEAR A . Evaporator The flow of refrigerant through the evaporator may Your new high - efficiency refrigerator may make unfamiliar create a boiling or gurgling sound . sounds . These are all normal sounds and soon will become familiar to you . They also indicate your refrigerator is operating B . Evaporator Fan as designed . Hard surfaces , such as vinyl or wood floors , You may hear air being forced through the refrigerator walls , and kitchen cabinets may make sounds more by the evaporator fan . noticeable . Listed below are descriptions of some of the most C . Defrost Heater common sounds you may hear , and what is causing them . During defrost cycles , water dripping onto the defrost heater may cause a hissing or sizzling sound . After NOTE : Rigid foam insulation is very energy efficient , defrosting , a popping sound may occur . but is not a sound insulator . IMPORTANT : During the automatic defrost cycle , you may notice a red glow in the vents on the back wall of your freezer compartment . This is normal during the defrost cycle . D . Automatic Ice Maker If your refrigerator is equipped with an automatic ice maker , you will hear ice cubes falling into the ice bin . E . Cold Control & Defrost Timer or Automatic Defrost Control These parts can produce a snapping or clicking sound when turning the refrigerator on and off . The timer also produces sounds similar to an electric clock . F . Condenser Fan If condenser coils are located underneath your refrigerator as shown in the drawing at the left , you have a condenser fan . You may hear air being forced through the condenser by the condenser fan . G . Compressor Modern , high - efficiency compressors operate much faster than older models . The compressor may have a high - pitched hum or pulsating sound . H . Water Valve If your refrigerator is equipped with an automatic ice maker , you will hear a buzzing sound as the water valve opens to fill the ice maker during each cycle . I . Drain Pan ( Nonremovable ) You may hear water running into the drain pan during the defrost cycle . The drain pan will be located on top of the compressor for air - cooled condensers ( black coils on back of refrigerator ) . J . Condenser Coils ( Fan - cooled models only ) 17
Page: 18

Care & Cleaning Keep your refrigerator and freezer clean to prevent odor build - up . Wipe up any spills immediately and clean both sections at least twice a year . Never use any type of scouring pads , brushes , abrasive cleaners or strong alkaline solutions on any surface . Do not wash any removable parts in a dishwasher . Always unplug the electrical power cord from the wall outlet before cleaning . • When moving the refrigerator , pull straight out . Do not shift the refrigerator from side to side as this may tear or gouge the floor covering . If the refrigerator has an automatic ice maker , be careful not to move the refrigerator beyond the plumbing connections . • Dampobjectssticktocoldmetalsurfaces . Donottouchrefrigeratedsurfaceswithwetordamphands . • NeveruseCHLORIDEtocleanstainlesssteel . NOTES : • Turning the refrigerator temperature control to “ 0 ” turns off the compressor , but does not disconnect electrical power to the light bulb or other electrical components . To turn off power to your refrigerator , you must unplug the power cord from the wall outlet . • Donotuserazorbladesorothersharpinstrumentswhichcanscratchtheappliancesurfacewhenremoving adhesive labels . Any glue left from tape or labels can be removed with a mixture of warm water and mild detergent , or , touch the glue residue with the sticky side of tape you have already removed . Do not remove the serial plate . Care & Cleaning Chart Part What To Use Tips and Precautions Interior / Door Use 2 tablespoons of baking soda in 1 quart of warm water . Be sure to wring • Soap and water Liner excess water out of sponge or cloth before cleaning around controls , • Baking soda and water light bulb or any electrical part . Wipe gaskets with a clean soft cloth . Door Gaskets • Soap and water • Soap and water Do not wash any removable items ( bins , drawers , etc . ) in dishwasher . Drawers / Bins Allow glass to warm to room temperature before immersing in warm water . • Soap and water Glass Shelves • Glass cleaner • Mild liquid sprays • Soap and water Vacuum dust from front of toe grille . Remove toe grille ( See illustration on Toe Grille page 4 ) . Vacuum backside and wipe with sudsy cloth or sponge . Rinse and • Mild liquid sprays dry . • Vacuum attachment • Soap and water Exterior and Do not use commercial household cleaners , ammonia , or alcohol to clean Handles handles . • Soap and water Exterior and Never use CHLORIDE to clean stainless steel . • Ammonia Handles • Stainless Steel Cleaners Clean stainless steel front and handles with non - abrasive soapy water and a ( Stainless Steel dishcloth . Rinse with clean water and a soft cloth . Wipe stubborn spots with an Models Only ) ammonia - soaked paper towel , and rinse . Use a non - abrasive stainless steel cleaner . These cleaners can be purchased at most home improvement or major department stores . Always follow manufacturer's instructions . NOTE : Always clean , wipe and dry with the grain to prevent cross - grain scratching . Wash the rest of the cabinet with warm water and mild liquid detergent . Rinse well , and wipe dry with a clean soft cloth . No need to clean unless operating refrigerator under particularly dusty or • Condenser Cleaning Condenser greasy conditions , or if there is significant pet traffic in your home . If cleaning Brush is available from Coils is necessary , remove toe grille and use extended vacuum attachment and your dealer . ( Fan - cooled condenser cleaning brush to remove dust build - up from condenser coils ( see • Vacuum Cleaner models only ) item “ J ” in illustration on page 17 for location ) . Condenser Use the dusting tool attachment on your vacuum to remove dust build - up on • Vacuum Cleaner Coils the condenser coils ( black tubes and wires ) attached to the back of air - cooled ( Air - cooled refrigerators only . models only ) Some models have defrost water pan located on top of compressor at bottom • Soap and water Defrost Water rear of refrigerator ( see illustration on next page ) . Wipe water pan with damp Pan cloth . NOTE : The defrost water pan is NOT removable . 18
Page: 19

Care & Cleaning ( continued ) NEVER CLEAN CONDENSER ( SOME MODELS ) Avoid cuts when replacing light bulbs , If your refrigerator is wear gloves . equipped with a Never Clean condenser , there’s no need to clean the condenser under normal operating conditions . If the refrigerator is operated under particularly dusty or greasy conditions , or Defrost Water Pan ( some models ) if there is significant pet traffic in your home , it may be necessary to periodically clean the condenser for maximum efficiency . Freezer Light Cover Removal REPLACING THE FREEZER LIGHT BULB ( SOME MODELS ) 1 . Unplugrefrigerator . 2 . Wearglovesasprotectionagainstpossiblebroken glass . 3 . Unsnaplightshieldasshown . 4 . Unscrewandreplaceoldbulbwithanappliancebulb of the same wattage . 5 . Replacelightshield . 6 . Remembertoplugtherefrigeratorbackin . Refrigerator Mid - Level Light Cover Removal Vacation and Moving Tips • Leave refrigerator operating during vacations of 3 weeks or less . • Use all perishable items from refrigerator compartment . Short Vacations • Turn automatic ice maker off and empty ice bucket , even if you will only be gone for a few days . • Remove all food and ice if you will be gone one month or more . • Turn controls to " O " ( the OFF position ) and disconnect power . • Turn off automatic ice maker and turn water supply valve to closed position . Long • Clean interior thoroughly . Vacations Leave both doors open to prevent odors and mold build - up . Block doors open if • necessary . • Remove all food and ice . • If using handcart , load from side . Moving • Adjust rollers all the way up to protect them during sliding or moving . • Pad cabinet to avoid scratching surface . 19
Page: 20

Warranty Information REFRIGERATOR WARRANTY Your refrigerator is protected by this warranty WARRANTY THROUGH OUR AUTHORIZED SERVICERS , THE CONSUMER WILL BE PERIOD WE WILL : RESPONSIBLE FOR : FULL ONE - YEAR One year from Pay all costs for repairing or replacing any parts of this Costs of service calls that are listed under WARRANTY original purchase appliance which prove to be defective in materials or NORMAL RESPONSIBILITIES OF THE date . workmanship . Excludes original and replacement Ice & Water CONSUMER . * filter cartridges ( if equipped ) . Original and replacement cartridges are warranted for 30 days ( parts only ) . nd TH LIMITED 2 – 5 Second through fifth Repair or replace any parts in the cabinet liner or sealed Costs for pickup and delivery of the appliance YEAR WARRANTY years from original refrigeration system ( compressor , condenser , evaporator , required because of service . Costs for labor , parts ( Cabinet Liner and purchase date . dryer or tubing ) which prove to be defective in materials or and transportation other than with respect to the Sealed System ) workmanship . cabinet liner or Sealed Refrigeration System . LIMITED Time periods listed All of the provisions of the full warranties above and the Costs of the technician's travel to the home and any WARRANTY above . exclusions listed below apply . costs for pick up and delivery of the appliance ( Applicable to the required because of service . State of Alaska ) In the U . S . A . . and Puerto Rico , your appliance is warranted by Electrolux Major Appliances North America , a division of Electrolux Home Products , Inc . In Canada , your appliance is warranted by Electrolux Major Appliances North America , a division of Electrolux Canada Corp . Electrolux Home Products , Inc . and Electrolux Canada Corp . are referred to in this warranty as “ Electrolux ” . We authorize no person to change or add to any of our obligations under this warranty . Our obligations for service and parts under this warranty must be performed by us or an authorized Electrolux servicer . * NORMAL This warranty applies only to products in ordinary household use , and the consumer is responsible for the items RESPONSIBILITIES listed below : OF THE CUSTOMER 1 . Proper use of the appliance in accordance with instructions provided with the product . 2 . Proper installation by an authorized servicer in accordance with instructions provided with the appliance and in accordance with all local plumbing , electrical and / or gas codes . 3 . Proper connection to a grounded power supply of sufficient voltage , replacement of blown fuses , repair of loose connections or defects in house wiring . 4 . Expenses for making the appliance accessible for servicing , such as removal of trim , cupboards , shelves , etc . , which are not a part of the appliance when it was shipped from the factory . 5 . Damages to finish after installation . 6 . Replacement of light bulbs and / or fluorescent tubes ( on models with these features ) . EXCLUSIONS This warranty does not cover the following : 1 . CONSEQUENTIAL OR INCIDENTAL DAMAGES SUCH AS PROPERTY DAMAGE AND INCIDENTAL EXPENSES RESULTING FROM ANY BREACH OF THIS WRITTEN OR ANY IMPLIED WARRANTY . Note : Some states do not allow the exclusion or limitation of incidental or consequential damages , so this limitation or exclusion may not apply to you . 2 . Service calls which do not involve malfunction or defects in workmanship or material , or for appliances not in ordinary household use . The consumer shall pay for such service calls . 3 . Damages caused by services performed by servicers other than Electrolux , or its authorized servicers ; use of parts other than genuine Electrolux parts ; obtained from persons other than such servicers ; or external causes such as abuse , misuse , inadequate power supply or acts of God . 4 . Products with original serial numbers that have been removed or altered and cannot be readily determined . IF YOU NEED Keep your bill of sale , delivery slip , or some other appropriate payment record . The date on the bill establishes the SERVICE warranty period should service be required . If service is performed , it is in your best interest to obtain and keep all receipts . This written warranty gives you specific legal rights . You may also have other rights that vary from state to state . Service under this warranty must be obtained by contacting Electrolux . This warranty only applies in the 50 States of the U . S . A . and Puerto Rico , and Canada . Product features or specifications as described or illustrated are subject to change without notice . USA Canada 800 - 944 - 9044 800 - 265 - 8352 Electrolux Major Appliances North America , Electrolux Major Appliances North America , a division of Electrolux Home Products , Inc . a division of Electrolux Home Products , Inc . P . O . Box 212378 5855 Terry Fox Way Augusta , GA 30917 Mississauga , Ontario L5V 3E4 20
Page: 21

ATTENTION To Properly Install Your Refrigerator See “ Installation ” Section On Pages 4 - 5 OR To Reverse The Doors See “ Door Removal & Reversal ” Section On Pages 6 - 9 Before You Call Before calling for service , review this list . It may save you time and Common expense . This list includes common occurrences that are not the result of Occurrences defective workmanship or materials in this appliance . • Ensure plug is tightly pushed into electrical outlet . • Check / replace fuse with a 15 amp time - delay fuse . Reset circuit breaker . Refrigerator does not run . • The temperature control is turned to " " . O Refrigerator may be in defrost cycle . Wait 20 minutes and check again . • • Set freezer control to a warmer setting until freezer temperature is Freezer temperature too cold . satisfactory . Allow 24 hours for the temperature to stabilize . Refrigerator temperature is satisfactory . Refrigerator temperature too cold . • Set refrigerator control to a warmer setting . Allow 24 hours for temperature to stabilize . Then check freezer temperatures and adjust Freezer temperature is as needed . satisfactory . • The cabinet is not level . * Refrigerator is noisy or vibrates . • Floor is weak . • Interior needs to be cleaned . Odors in refrigerator . • Foods that produce odors should be covered or wrapped . • Replace light bulb . • Ensure plug is tightly pushed into electrical outlet . Cabinet light not working . • Light switch may be stuck . Push in light switch , located on the refrigerator control box , to release . • Ensure the Wire Signal Arm is not in UP position . Ice maker should produce 4 to 5 pounds of ice in a 24 hour period . • Automatic ice maker not working . • Water supply is turned off . ( some models ) • Water pressure is too low . • The freezer is not cold enough . * See Normal Operating Sounds and Sights section on page 17 . 21
Search in Refrigerator on ebay