Home | Register Login | Wanted Manuals | MarketPlace | Members Area | Manuals Manufacturer Directory | UPC Lookup | Information Pages | Policy


Back To RYOBI WeedWacker_Weed-Trimmer       Model: 825r RYOBI 4-Cycle Gas Trimmer
Regular Text Search or Search by Model Number

Register / log-in to add to your Hammerwall Collection.
Manual Location

Videos About This Item
Loading...

This is a partial text extraction from the pdf, to download the pdf, click the Manual tab. If you want to search this text, hold control and F, and type the word you are looking for.

Page: 1

OPERA TOR " S MANUAL FOR QUESTIONS , CALL 1 - 800 - 345 - 8746 in U . S . or 1 - 800 - 668 - 1238 in CANADA www . RyobiOutdoor . com IMPORTANT MANUAL DO NOT THROW AWAY
Page: 2

i . THANK YOU California Proposition 65 Warning . . . . . . . . . . . . . . . . 3 Thank you for buying this quality product . This modern IL Rules for Safe Operation . . . . . . . . . . . . . . . . . . . . . 3 - 7 outdoor power tool will provide many hours of useful A . Important Safety Information . . . . . . . . . . . . . . . . . 4 service . You will find it to be a great labor - saving device . B . Safety and International Symbols . . . . . . . . . . . . . 67 This operator's manual provides you with easy - to - C , Know Your Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . understand operating instructions . Read the whole Ill . Assembly Instructions . . . . . . . . . . . . . . . . . . . . . . . . 88 manual and follow at ! the instructions to keep your new A . Installing and Adjusting the J handle . . . . . . . . . . outdoor power tool in top operating condition . B , Installing the Cutting Attachment Shield . . . . . . . . 8 PRODUCT REFERENCES , ILLUSTRATIONS AND IV . Oil and Fuel Information . . . . . . . . . . . . . . . . . . . . 9 - 10 SPECIFICATIONS A . Recommended Oil Type . . . . . . . . . . . . . . . . . . . . . 9 All information , illustrations and specifications in this B . Adding Oil to the Crankcase . . . . . . . . . . . . . . . . . . 9 manual are based on the latest product information C . Recommended Fuel Type . . . . . . . . . . . . . . . . . . . 10 available at the time of printing . We reserve the right to D . Fueling the Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 make changes at any time without notice . V , Starting / Stopping Instructions . . . . . . . . . . . . . . . . . 11 Copyright ' ' _ 2003 MTD SOUTHWEST INC All Rights Reserved . Vl . Operating Instructions . . . . . . . . . . . . . . . . . . . . 12 - 13 SpeedSpool C ' _ is a registered trademark of MTD A . Operating the EZ - Link System . . . . . . . . . . . . . . . 12 SOUTHWEST INC . B . Holding the Trimmer . . . . . . . . . . . . . . . . . . . . . . 13 C . Adjusting Trimming Line Length . . . . . . . . . . . . . 13 D . Tips for Best Trimming Results . . . . . . . . . . . . . . 13 SERVICE INFORMATION E , Decorative Trimming . . . . . . . . . . . . . . . . . . . . . . 13 Service on this unit both within and after the warranty VII . Maintenance and Repair Instructions . . . . . . . . . 14 - 2214 period should be performed only by an authorized and A . Maintenance Schedule . . . . . . . . . . . . . . . . . . . . approved service dealer . B . Line Installation for the SpeedSpool . . . . . . . . . . 14 C . Installing a Prewound Reel . . . . . . . . . . . . . . . . . 15 • Call 1 - 800 - 345 - 8746 in the United States , or D . Cleaning the SpeedSpool . . . . . . . . . . . . . . . . . . 16 1 - 800 - 668 - 1238 in Canada , to obtain a list of E . SpeedSpool Replacement Parts . . . . . . . . . . . . . 16 authorized service dealers near you F . Checking the Oil Level . . . . . . . . . . . . . . . . . . . . . . 17 G . Changing the Oil Level . . . . . . . . . . . . . . . . . . . . . . 17 Or H , Air Filter Maintenance . . . . . . . . . . . . . . . . . . . . . 18 I . Carburetor Adjustment . . . . . . . . . . . . . . . . . . . . 1189 • Go to www . RyobiOutdoor . com on the World Wide J . Rocker Arm Clearance . . . . . . . . . . . . . . . . . . . . . . Web for a list of authorized service dealers K . Replacing the Spark Plug . . . . . . . . . . . . . . . . . . 21 L . Spark Arrestor Maintenance . . . . . . . . . . . . . . . . . 21 M . Cleaning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 DO NOT RETURN THE UNIT TO THE RETAILER . N . Storage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 O . Long Term Storage . . . . . . . . . . . . . . . . . . . . . . . 22 NOTE : PROOF OF PURCHASE WILL BE REQUIRED P . Transporting the Unit . . . . . . . . . . . . . . . . . . . . . . . 22 FOR WARRANTY SERVICE . Q . Accessories / Replacement parts . . . . . . . . . . . . . . 22 VIII . Troubleshooting Chart . . . . . . . . . . . . . . . . . . . . . . . 23 Make sure you carefully read and understood this manual before starting or operating this equipment . IX . Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 THIS PRODUCT IS COVERED BY ONE OR MORE US X , Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 PATENTS , OTHER PATENTS PENDING . Xl . Parts List . . . . . . . . . . . . . . . . . . . . . . . . . . . Back Cover CONTENTS OF CARTON Model 825r Trimmer with J - Handle SpeedSpooP ' Bump Head Cutting Attachment Operator's Manual Product Registration Card Bottle of 4 - Cycle Oil
Page: 3

THE ENGINE EXHAUST FROM THIS PRODUCT CONTAINS CHEMICALS KNOWN TO THE STATE OF CALIFORNIA TO CAUSE CANCER , BIRTH DEFECTS OR OTHER REPRODUCTIVE HARM . NOTE : For users on U . S . Forest Land and in the states of California , Maine , Oregon and Washington . All U . S . Forest Land and the state of California ( Public Resources Codes 4442 and 4443 ) , Oregon and Washington require , by law that certain internal combustion engines operated on forest brush and / or grass - covered areas be equipped with a spark arrestor , maintained in effective working order , or the engine be constructed , equipped and maintained for the prevention of fire . Check with your state or local authorities for regulations pertaining to these requirements . Failure to follow these requirements could subject you to liability or a fine . This unit is factory equipped with a spark arrestor . If it requires replacement , ask your local service dealer to install the Accessory Part # 180890 Spark Arrestor Kit . Read the Operator's Manual ( s ) and follow all warnings and safety instructions . Failure to do so can result in serious injury to the operator and / or bystanders . FOR QUESTIONS , CALL 1 - 800 - 345 - 8746 IN U . S . OR 1 - 800 - 668 - 1238 in CANADA The purpose of safety symbols is to attract your I SYMBOL MEANING attention to possible dangers . The safety symbols , and their explanations , deserve your careful attention and understanding . The safety warnings do not by themselves eliminate any danger . The instructions or will result in serious injury to yourself or to others . Always follow the safety warnings they give are not substitutes for proper I _ I prAeNcaGuEtioRn : s Fatoilurreedutoceobtehye arisskafoeftyfirew , arning accident prevention measures . electric shock and personal injury , I SYMBOL MEANING warning can result in injury to yourself and NOTE : Advises you of information or instructions vital others , Always follow the safety to the operation or maintenance of the , _ . IWpreAcRauNtiIoNnsG : Ftoarieludruecteo othbeeyrisaksoaffefitrye , equipment . electric shock and personal injury . SAFETY ALERT SYMBOL : Indicates I danger , warning or caution . Attention is may result in property damage or personal _ , AUTION : Failure to obey a safety warning required in order to avoid serious personal injury to yourself or to others . Always follow I injury . May be used in conjunction with the safety precautions to reduce the risk of other symbo s or pictographs . f re , electr c shock and persona njury .
Page: 4

• Add fuel in a clean , well - ventilated outdoor area where READ ALL INSTRUCTIONS there are no sparks or flames . Slowly remove the fuel BEFORE OPERATING cap only after stopping engine . Do not smoke while fueling . Wipe up any spilled fuel from the unit • Read the instructions carefully . Be familiar with the immediately . controls and proper use of the unit . • Avoid creating a source of ignition for spilled fuel . Do • Do not operate this unit when tired , ill or under the not start the engine until fuel vapors dissipate . influence of alcohol , drugs or medication . • Move the unit at least 30 feet ( 9.1 m ) from the fueling • Children and teens under the age of 15 must not use source and site before starting the engine . Do not the unit , except for teens guided by an adult . smoke . Keep sparks and open flames away from the area while adding fuel or operating the unit . • Inspect the unit before use . Replace damaged parts . Check for fuel leaks . Make sure all fasteners are in WHILE OPERATING place and secure . Replace cutting attachment parts • Never start or run the unit inside a closed room or that are cracked , chipped or damaged in any way . Make sure the cutting attachment is properly installed building . Breathing exhaust fumes can kill . Operate and securely fastened . Be sure the cutting attachment this unit only in a well ventilated outdoor area . shield is properly attached , and positioned as • Wear safety glasses or goggles that are marked as recommended . Failure to do so can result in personal meeting ANSI Z87 . 1 - 1989 standards . Also wear injury to the operator and bystanders , as well as ear / hearing protection when operating this unit . Wear damage to the unit . a face or dust mask if the operation is dusty . Long sleeve shirts are recommended . • Use only 0.080 inch ( 2.03 mm ) diameter Genuine Factory PartJ M replacement line . Never use metal - • Wear heavy , long pants , boots and gloves . Do not reinforced line , wire or rope . These can break off and wear loose clothing , jewelry , short pants , sandals or become dangerous projectiles . go barefoot . Secure hair above shoulder level . • Be aware of the risk of injury to the head , hands and • The cutting attachment shield must always be in place feet . while operating the unit . Do not operate unit without • Clear the area to be cut before each use . Remove all both trimming lines extended , and the proper line objects such as rocks , broken glass , nails , wire or installed . Do not extend the trimming line beyond the string . They can be thrown or become entangled in the length of the shield . cutting attachment . Clear the area of children , • This unit has a clutch . The cutting attachment remains bystanders , and pets . At a minimum , keep all children , bystanders and pets outside a 50 - foot ( 15 m . ) radius ; stationary when the engine is idling , if it does not , have the unit adjusted by an authorized service technician . there still may be a risk to bystanders from thrown objects . Bystanders should be encouraged to wear • Adjust the J - handle to your size to provide the best eye protection . If you are approached , stop the engine grip . and cutting attachment immediately . • Be sure the cutting attachment is not in contact with • Squeeze the throttle control and check that it returns anything before starting the unit . automatically to the idle position . Make all adjustments or repairs before using unit . • Use the unit only in daylight or good artificial light . • This unit was not designed to be used as a • Avoid accidental starting . Be in the starting position brushcutter . Do not attach or operate this unit with any whenever pulling the starter rope . The operator and type of brushcutting blade or brushcutting attachment . unit must be in a stable position while starting . See Starting / Stopping Instructions . SAFETY WARNINGS FOR GAS TRIMMERS • Use the right tool . Only use this tool for the purpose • Store fuel only in containers specifically designed and intended . approved for the storage of such materials . • Do not overreach . Always keep proper footing and • Always stop the engine and allow it to cool before balance . filling the fuel tank . Never remove the cap of the fuel tank , or add fuel , when the engine is hot . Neverin • Always hold the unit with both hands when operating . operate the unit without the fuel cap securely place . Keep a firm grip on both the front and rear handle or Loosen the fuel tank cap slowly to relieve any pressure grips . in the tank . • Keep hands , face , and feet at a distance from all moving parts . Do not touch or try to stop the cutting attachment when it is rotating . • Do not touch the engine or muffler . These parts get extremely hot from operation . They remain hot for a short time after you turn off the unit .
Page: 5

• Donotoperatetheenginefasterthanthespeed OTHER SAFETY WARNINGS neededto cut , trimoredge . Donotruntheengineat • Never store the unit , with fuel in the tank , inside a highspeedwhenyouarenotcutting . building where fumes may reach an open flame or spark . • Alwaysstoptheenginewhencuttingisdelayedor • Allow the engine to cool before storing or transporting . whenwalkingfromonecuttinglocationto another . Be sure to secure the unit while transporting . • Ifyoustrikeorbecomeentangledwithaforeign • Store the unit in a dry area , locked up or up high object , stoptheengineimmediatelayndcheckfor to prevent unauthorized use or damage , out of the damageD . onotoperatebeforerepairingdamageD . o reach of children . notoperatetheunitwithlooseordamagedparts . Never douse or squirt the unit with water or any other • Stopandswitchtheengineto offformaintenance , liquid . Keep handles dry , clean and flee from debris . repair , orforchangingthecuttingattachmenotrother Clean after each use . See the Cleaning and Storage attachments . instructions . • UseonlyGenuineFactoryPartsTM replacement parts • Keep these instructions . Refer to them often and use and accessories for this unit . These are available from them to instruct other users . If you loan someone this your authorized service dealer . Use of any unit , also loan them these instructions . unauthorized parts or accessories could lead to serious injury to the user , or damage to the unit , and SAVE THESE INSTRUCTIONS void your warranty . • Keep unit clean of vegetation and other materials . They may become lodged between the cutting attachment and shield . • To reduce fire hazard , replace faulty muffler and spark arrestor , keep the engine and muffler free from grass , leaves , excessive grease or carbon build up .
Page: 6

SAFETY AND INTERNATIONAL SYMBOLS This operator's manual describes safety and international symbols and pictographs that may appear on this product . Read the operator's manual for complete safety , assembly , operating and maintenance and repair information . SYMBOL MEANING SYMBOL MEANING • THROWN OBJECTS AND ROTATING CUTTER CAN CAUSE SEVERE INJURY indicates danger , warning , or / - / _ . . _ caution . May be used in conjunction • SAFETY ALERT SYMBOL _ _ WARNING : Do not operate without with other symbols or pictographs . - / the cutting attachment shield in place . Keep away from the rotating cutting attachment . WARNING - READ OPERATOR'S MANUAL • ONIOFF STOP CONTROL Read the Operator's Manual ( s ) and ON / START / RUN follow all warnings and safetyo instructions . Failure to do s can result in serious injury to the operator and / or bystanders . • ONIOFF STOP CONTROL OFF OR STOP WEAR EYE AND HEARING PROTECTION HOT SURFACE WARNING WARNING : Thrown objects and Do not touch a hot muffler or loud noise can cause severe eye cylinder . You may get burned . These injury and hearing loss . Wear eye parts get extremely hot from protection meeting ANSI Z87 . 1 - 1989 operation . When turned off they standards and ear protection when remain hot for a short time . operating this unit . Usea full face shield when needed . SHARP BLADE KEEP BYSTANDERS AWAY WARNING : Sharp blade on cutting attachment shield . To prevent WARNING : Keep all bystanders , serious injury , do not especially children and pets , at least touch line cutting blade . 50 feet ( 15 m . ) from the operating area . • UNLEADED FUEL Always use clean , fresh unleaded fuel . • OIL Refer to operator's manual for the proper type of oil .
Page: 7

Spark Arrestor APPLICATIONS Muffler Asatrimmer : Cuttinggrassandlightweeds Edging Decorativterimmingaroundtrees , fencese , tc . Otheroptionaal ccessoriems aybeusedwiththe 825r.Referto Operating the EZ - Link System for a Fuel Cap list of add - ons . Starter Rope Grip On / Off Stop Control Shaft Grip Throttle Control EZ - Link TM J - Handle Choke Lever Spark Plug Shaft Housing Air Filter Cover \ k Primer Bulb Cutting Attachment Shield J Line Cutting Blade / Attachment / Dipstick Engine Feet
Page: 8

INSTALL AND ADJUST THE J - HANDLE INSTALL THE CUTflNG ATTACHMENT SHIELD The J - handle comes installed on this unit . Use the Use the following instructions if the cutting attachment following information if you ever need to reinstall it . shield on your unit is not installed . 1 , Place the J - handle between the top and middle clamp pieces ( Fig . 1 ) . injury , never operate the trimmer without ( 4 ) _ lb WARNING : TO prevent serious personal the cutting attachment shield in place . 1 , Place the cutting attachment shield onto the shaft Top Clamp housing above the clamp assembly ( Fig . 4 ) . 2 . Push the cutting attachment shield down to the top of Middle Clamp the cutting attachment assembly and then rotate the cutting attachment shield until the screw holes align and the guard fits into the recessed pocket ( Fig . 5 ) . Bottom Clamp _ 3 , Nuts _ " _ ' Install the screws with Phillips screwdriver ( Fig . 6 ) . Fig . 1 Clamp Shaft Housing 2 . While holding the three pieces together , install the four Assembly _ _ _ . ( 4 ) screws through the top clamp and into middle clamp . NOTE : The holes in the top and middle clamp will line up only when assembled correctly . Attachment 3 . Place the clamps and the J - handle over the shaft Assembly housing and onto the bottom clamp . Cutting 4 . Hold each hex nut in the bottom clamp recess with a finger . Start screws with a large Phillips screwdriver . Do not tighten until you make the handle adjustment . 5 . Slide the J - handle in or out until the arrow / white line on the decal touches the clamp assembly ( Fig . 2 ) . You must first loosen the screws if the handle is pre - instaIled . Decal ( _ Fig . 2 Pocket CuttingAttachment 6 . While holding the unit in the operating position ( Fig . 3 ) , Shield position the J - handle to the location that provides you the best grip . Fig . 5 \ \ \ _ ( 4 ) Screws I Fig . 3 7 . Tighten the clamp screws evenly , until the J - handle Fig . 6 is secure .
Page: 9

2 . Place the unit on a flat level surface . 3 . Remove the oil plug / dipstick from the crankcase MAY CAUSE SERIOUS PERSONAL ( Fig . 8 ) . INJURY . Check and maintain the proper oil level in the crank case ; it is important and cannot be overemphasized , Check the oil I _ [ DANGER : OVERFILLING OIL CRANKCASE before each use and change it as needed . See Changing the Oil . RECOMMENDED OIL TYPE Using the proper type and weight of oil in the crankcase O - Ring is extremely important . Check the oil before each use and change the oil regularly , Failure to use the correct Oil Fill Plug / Dipstick - oil , or using dirty oil , can cause premature engine wear and failure , Use a high - quality SAE 30 weight oil of API ( American Oil Fill Hole / Petroleum Institute ) service class SF , SG , SH . ADDING OIL TO CRANKCASE : INITIAL USE Fig . 8 NOTE : This unit is shipped without oil . In order to avoid damage to the unit , put oil in the crankcase 4 . Pour the entire bottle of oil into the oil fill hole before you attempt to start the unit . ( Fig . 9 ) . Your unit is supplied with one 3.4 fluid oz . ( 100 ml . ) bottle of SAE 30 SF , SG , SH oil ( Fig . 7 ) . NOTE : Save the bottle of oil . It can be used to measure the correct amount during future oil changes . See Changing the Oil . 1 . Unscrew the top of the bottle of oil and remove the paper seal covering the opening . Replace the top . Next , cut the tip off the funnel spout ( Fig . 7 ) . Fig . 9 Funnel Spout _ NOTE : Never add oil to the fuel or fuel tank . 5 . Wipe up any oil that may have spilled and reinstall the oil fill plug / dipstick . Check oil before each use and change as needed . Refer to Changing the Oil . Fig . 7
Page: 10

RECOMMENDED FUEL TYPE FUELING THE UNIT Old fuel is the primary reason for improper unit performance . Be sure to use fresh , clean , unleaded and its vapors can explode if ignited . ] b avoid gasoline . serious personal injury , always stop the engine NOTE : This is a four cycle engine . In order to avoid and allow it to cool before filling the fuel tank . damage to the unit , do not mix oil with l _ i _ WDoARnoNtINsmG : okGe awsohliilneefililsinegxttrheemtealnyk . flaKmemepable gasoline . sparks and open flames away from the area . Definition of Blended Fuels 1 . Remove the fuel cap ( Fig . 10 ) . Today's fuels are often a blend of gasoline and oxygenates such as ethanol , methanol or MTBE ( ether ) . Alcohol - blended fuel absorbs water . As little as 1 % water in the fuel can make fuel and oil separate or form avoid injury from gasoline spray . [ _ WARNING : Remove the fuel cap slowly to acids when stored . Use fresh fuel ( less than 60 days old ) , when using alcohol - blended fuel . Using Blended Fuels If you choose to use a blended fuel , or its use is unavoidable , follow recommended precautions : Always use fresh unleaded gasoline Use the fuel additive STA - BIL _ ' _ or an equivalent Drain tank and run the engine dry before storing unit Using Fuel Additives The use of fuel additives , such as STA - BIL _ Gas Stabilizer or an equivalent , will inhibit corrosion and minimize the formation of gum deposits . Using a fuel additive can keep fuel from forming harmful deposits in the carburetor for up to six ( 6 ) months . Add 0.8 oz . ( 23 ml . ) of fue ! additive per gallon of fuel according to the instructions on the container . NEVER add fuel additives Fig . 10 directly to the unit's gas tank . 2 . Place the gas container's spout into the fill hole on the fuel tank ( Fig . 10 ) and fill the tank . ventilated outdoor area . Avoid creating a WARNING : Add gasoline in a clean , well - source of ignition for spilt fuel . NOTE : Do not overfill the tank . 3 . Wipe up any gasoline that may have spilled . 4 . Reinstall the fuel cap . the fuel cap securely in place . [ _ ARNING : Never operate the unit without 5 . Move the unit at least 30 ft . ( 9.1 m ) from the fueling source and site before starting the engine . NOTE : Dispose of the old gasoline in accordance to Federal , State and Local regulations . 10
Page: 11

STARTING INSTRUCTIONS ventilated area outdoors . Carbon monoxide II exhaust fumes can be lethal in a confined area . WAR ° Np'NerGaut : en ° t'nhti ' ' ynsawe " 1 - , in the starting position when pulling the starter rope ( Fig . 13 ) . The operator and unit must be in a stable position while starting to StartlStop \ I Control avoid serious personal injury . WARNING : Avoid accidental starting . Remain Make sure that any Add - On item is installed correctly and secure before starting the unit . Fig . 11 1 . Check the oil level in the crankcase . Refer to Checking the Oil Level . 2 . Fill the fuel tank with fresh , clean unleaded gasoline . Refer to Fueling the Unit . Choke Lever 3 . Put the Start / Stop Engine Control in the START [ I ] position ( Fig . 11 ) . 4 . Place the choke lever in the FULL choke ( A ) H position ( Fig . 12 ) . NOTE : Slide the choke lever directly above the appropriate Bulb symbol on filter cover decal ( Fig . 12 ) . 5 . Fully press and release the primer bulb slowly 10BULB , times until FUEL IS VISIBLE IN THE PRIMER If you can't see fuel in the bulb , press and release the Fig . 12 bulb as many times as it takes before you can see fuel in it ( Fig . 12 ) . 6 . Squeeze the throttle control to the wide open ( full throttle ) position . 7 . With the unit in the starting position ( Fig . 13 ) and the choke in the FULL ( A ) H position , pull the starter rope briskly 5 times . If the engine attempts to run before the fifth pull , proceed to step 8 . Starter Rope 8 . Move the choke lever to the PARTIAL ( B ) Ixl position ( Fig . 12 ) . NOTE : The engine will not run in the FULL choke ( A ) H position . 9 . Pull the starter rope 1 to 3 pulls until the engine starts . Run for 15 - 30 seconds . If the unit fails to start , return to step 7 . Throttle Control 10 . Move the choke lever to the RUN ( C ) I _ 1 position and run at full throttle for 30 seconds . Fig . 13 11 . Release the throttle control to the idle position and begin operation . STOPPINGINSTRUCTIONS NOTE : If the engine does not start using these 1 . Release your hand from the throttle control ( Fig . 13 ) . procedures , repeat steps 5 through 11 using Allow the engine to cool down by idling . TWO ( 2 ) pulls in the FULL choke ( A ) position . 2 . Put the On / Off Stop Control in the OFF ( O ) position NOTE : Choking is unnecessary when starting a warm ( Fig . 11 ) . engine . Put the On / Off Stop Control in the ON position ( Fig . 11 ) and start in PARTIAL choke ( B " - ) position ( Fig . 12 ) . After starting , place the choke lever in the RUN ( C I { I ) position . 11
Page: 12

OPERATING THE EZ - LINK TM SYSTEM 2 . While firmly holding the add - on , push it straight into the EZ - LinM M coupler ( Fig . 15 ) . The EZ - Link TM system enables the use of these optional Add - Ons , NOTE : Aligning the release button with the guide recess Blower / Vacuum . . . . . . . . . . . . . . . . . . . . . . . . . . BV720r will help installation ( Fig . 14 ) . Cultivator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GC720r Release Button EZ - Link TM Coupler Edger . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LE720r Primary Hole Hedge Trimmer . . . . . . . . . . . . . . . . . . . . . . . . . . HS720r Snow Thrower . . . . . . . . . . . . . . . . . . . . . . . . . . . ST720r Straight Shaft Trimmer . . . . . . . . . . . . . . . . . . . . SS725r Tree Pruner . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TP720r Turbo Blower . . . . . . . . . . . . . . . . . . . . . . . . . . . . TB720r Upper Shaft Housing Lower Shaft Housing operator's manual for each add - on prior to Fig . 15 WARNING : Read and understand the operation , 3 . Turn the knob clockwise to tighten ( Fig . 16 ) . Removing the Cutting Attachment or Add - Ons 1 . Turn the knob counterclockwise to loosen ( Fig . 14 ) . primary hole and securely tighten the knob _ i CAUTION : Lock the release button in the 2 . Press and hold the release button ( Fig , 14 ) . before operat ng th sun t . 3 . While firmly holding the upper shaft housing , pull the cutting attachment or add - on straight out of the 90 Edging Hole / \ EZ - Link TM coupler ( Fig . 15 ) . " \ _ / / and damage to the unit , shut unit off before WARNING : To avoid serious personal injury removing or installing add - ons . 180 " Edging Hole Installing the Cutting Attachment or Add - Ons NOTE : To make installing or removing the add - on easier , place the unit on the ground or on a work bench . 1 . Turn knob counterclockwise to loosen ( Fig . 14 ) . Fig . 16 EZ - LinW M Coupler Release Button CAUTION : The cutting attachment and add - ons with the EZ - Link TM system are to be used in the primary hole unless stated otherwise in the specific add - ons operator's manual , Using the wrong hole could lead to personal injury , or damage to the unit , For edging when using the line head cutting attachment with EZ - Link rM models , lock the release button of the Knob cutting attachment into the 90 ° edging hole or the 180 ° \ edging hole ( Fig . 16 ) . Guide Recess Fig . 14 12
Page: 13

HOLDING THE TRIMMER NOTE : Do not rest the Bump Head TM on the ground while the unit is running . Some line breakage will occur from : and body protection to reduce the risk of - - _ WARNING : Always wear eye , hearing , foot Entanglement with foreign matter injury when operating this unit . Normal line fatigue Before operating the unit , stand in the operating position ( Fig . 17 ) . Check for the following : Attempting to cut thick , stalky weeds The operator is wearing eye protection and proper Forcing the line into objects such as walls or fence clothing posts With a slightly - bent right arm , the operator's hand is holding the shaft grip cutting blade assembly . Excessive line length CAUTION : Do not remove or alter the line The operator's left arm is straight , the left hand will make the clutch overheat . This may lead to holding the J - handle serous persona njury or damage to the un t . The unit is at waist level TIPS FOR BEST TRIMMING RESULTS The cutting attachment is parallel to the ground and Keep the cutting attachment parallel to the ground . easily contacts the grass without the need to bend over Do not force the cutting attachment . Allow the tip of the line to do the cutting , especially along walls . Cutting with more than the tip will reduce cutting efficiency and may overload the engine . Cut grass over 8 inches ( 200 mm ) by working from top to bottom in small increments to avoid premature line wear or engine drag . Cut from right to left whenever possible . Cutting to the left improves the unit's cutting efficiency . Clippings are thrown away from the operator . Slowly move the trimmer into and out of the cutting area at the desired height . Move either in a forward - backward or side - to - side motion . Cutting shorter lengths produces the best results . Trim only when grass and weeds are dry . Fig . 17 The life of your cutting line is dependent upon : ADJUSTING TRIMMING LINE LENGTH Following the trimming techniques The Bump Head TM cutting attachment allows you to What vegetation is being cut release trimming line without stopping the engine . To release more line , lightly tap the cutting attachment on the Where vegetation is cut ground ( Fig . 18 ) while operating the trimmer at high speed . For example , the line will wear faster when trimming NOTE : Always keep the trimming line fully extended . against a foundation wall as opposed to trimming Line release becomes more difficult when the around a tree . cutting line gets shorter . DECORATIVE TRIMMING Decorative trimming is accomplished by removing all vegetation around trees , posts , fences and more . Rotate the whole unit so that the cutting attachment is at a 30 ° angle to the ground ( Fig . 19 ) . Fig . 18 Each time the head is bumped , about 1 inch ( 25.4 mm ) of trimming line releases . A blade in the cutting attachment shield will cut the line to the proper length if any excess line is released . For best results , tap the bump knob on bare ground or hard soil . if you attempt a line release in tall grass , the engine may stall . Always keep the trimming line efullyn extended . Line release becomes more difficult wh the cutting line gets shorter . Fig . 19 13
Page: 14

MAINTENANCE SCHEDULE NOTE : Maintenance , replacement , or repair of the emission control devices and system may be Perform these required maintenance procedures at the performed by any non - road engine srepairervice frequency stated in the table . These procedures should establishment , individual or authorized also be a part of any seasonal tune - up . dealer . NOTE : Some maintenance procedures may require special tools or skills , tfyou are unsure about these procedures take your unit to any non - road perform maintenance or repairs with the unit running . Always service and repair a cool unit . I engine repair establishment , individual or authorized service dealer . , _ WARNING : To prevent serious inJury , never I the unit cannot start . Disconnect the spark plug wire to ensure that FREQUENCY MAINTENANCE REQUIRED REFER TO Before starting engine Fill fuel tank with fresh fuel Page 107 Check oil Page 1 Every 10 hours Clean and re - oil air filter Page 18 First change at 10 hours Change oil Page 17 Every 25 hours thereafter Change oil Page 17 Every 25 hours Clean spark arrestor Page 21 10 hours on new engine Check rocker arm to valve clearance and adjust Page 19 Every 25 hours Check rocker arm to valve clearance and adjust Page 19 Every 25 hours Check spark plug condition and gap Page 21 LINE INSTALLATION FOR THE SPEEDSPOOL ® length when installing trimming line on the II , _ WARNING : Always use the correct line wire , chain , or rope , etc . These can break off lineuinsTith , toeo linloengm , ay not release properly if the WARNING : Never use metal - reinforced line , and become dangerous projectiles . Always use Genuine Factory Parts TM 0.080 inch Top View Of The SpeedSpooP ( 2.03 mm ) replacement line . Lines other than those specified may make the engine overheat or fail . Arrows There are two methods to replace the SpeedSpool _ trimming line : Outer Spool • Wind the inner reel with new line • Install a pre - wound inner reel Winding the Inner Reel With New Line NOTE : It Is unnecessary to remove the bump knob to install a new trimming line , Inner Reel 1 . Cut two pieces of 0.080 inch ( 2.03 mm ) trimming line , 10 feet ( 3 m ) long . 2 . Hold the outer spool and turn the inner ree ! Bump Knob counterclockwise to line up the arrows on the outer spool and inner reel ( Fig . 20 ) . Fig . 20 14
Page: 15

3 , 7 , Pull old line out of the line loading and line locking Repeat procedures 4 - 6 with the second piece of line . holes ( Fig . 21 and 22 ) . 8 . Hold the outer spool . Wind the inner ree ! 4 . Insert a piece of trimming line straight into one of the counterclockwise until approximately four ( 4 ) inches two eyelets in the outer spool . Push it up through the ( 102 mm ) of line remain ( Fig . 24 ) . line loading hole in the inner reel ( Fig . 21 ) . Do not NOTE : Do not wind the inner reel before installing the bend the line when inserting it into the eyelet . second piece of line . Trimming Line Eyelet Line Loading Hole Fig . 21 Fig . 24 5 , insert the line into the locking hole ( Fig . 22 ) . Do not g , If winding the line becomes difficult or if the line push the line more than a 1 / 2 inch ( 12.7 ram ) into the jams , pull the ends of the line from the spool line locking hole . The line will form a small loop ( Fig . 25 ) . Continue winding the inner reel ( Fig . 22 ) when it is inserted correctly . counterclockwise . Line Locking Hole Fig . 25 Fig . 22 INSTALLING A PRE - WOUND REEL 6 , Pull the line from the outer spool until the line is tight 1 . Turn the bump knob counterclockwise and remove against the inner reel ( Fig . 23 ) . the bump knob , spring and foam seal ( Fig . 26 ) . Foam Seal _ Spring _ _ Bump Knob _ Fig . 23 Fig . 26 15
Page: 16

4 , 2 . Pulltheoldinnerreelwithexistinglinefromtheouter Remove any existing line from the inner ree ! before spool . cleaning . Remove any debris or grass from the knob , spring , inner reel and foam seal . Wash the inner reel 3 . Inserttheendsof theprewoundinnerreellineinto with warm soapy water ( Fig . 29 ) . theouterspooleyelets ( Fig . 27 ) . Pushthenewinner reel , arrowsideup , intotheouterspool . Inner Reel Fig . 29 5 , Clean the shaft and the inner surface of the outer spool . To clean the shaft underneath the plunger , press down on the plunger ( Fig . 30 ) . Remove any dirt Fig . 27 or debris from the shaft . 4 , Hold the inner reel in place and install the bump knob , spring and foam seal . Press down and turn the bump knob clockwise . Grasp the ends and pull Shaft \ firmly to release the line from the holding slots in the inner reel ( Fig . 25 ) . Plunger Releasing the Inner Reel If the SpeedSpool _ does not release line correctly , pull the ends of the line firmly from the spool ( Fig . 25 ) . If this does not the release line , follow the Cleaning the SpeedSpoof " _ instructions . CLEANING THE SPEEDSPOOL " _ Cleaning the SpeedSpool C ' ¢ may be necessary if : Fig . 30 A jammed or excessive line must be removed NOTE : The inner reel must be totally dry before The SpeedSpoo ! u _ becomes difficult to wind or does reinstalling it into the outer spool . Do not not operate correctly when bumping the head on the lubricate the inner reel or outer spool assembly . ground 6 . Place the inner reel into the outer spool . 1 . Hold the outer spool , and unscrew the bump knob counterclockwise ( Fig . 28 ) . 7 . Place the bump knob , spring and foam seal onto the inner reel ( Fig . 26 ) . 2 . Pull out the bump knob , spring and foam seal ( Fig . 26 ) . 8 . Press the bump knob down and tighten clockwise . 9 . Install new line as described in Line Installation for the SpeedSpoof " _ . SPEEDSPOOL C _ REPLACEMENT PARTS Replacement Line . . . . . . . . . . . . . . . . . . . . . . . . 181472 Replacement Line Cartridge . . . . . . . . . . . . . . . . 181460 inner Reel Spring . . . . . . . . . . . . . . . . . . . . . . . . 181465 Foam Seal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181467 inner Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181464 Bump Head TM Assembly . . . . . . . . . . . . . . . . . . . 181468 Fig . 28 ( Bump Knob , inner Reel , Spring ) 3 . Pull the inner reel with existing line from the outer These SpeedSpool replacement parts can be spool . purchased from your local authorized dealer . 16
Page: 17

CHECKING THE OIL LEVEL CHANGING THE OIL For a new engine , change the oil after the first 10 hours of operation . Change the oil while the engine is still warm , The wear and damage to the unit , always oil will flow freely and carry away more impurities . maintain the proper oil level in the crankcase . Never operate the unit with the CAUTION : To prevent extensive engineick . oil level below the bottom of the dipst when handling the unit . [ _ AUTION : Wear gloves to prevent injury The importance of checking and maintaining the proper 1 . Unplug spark plug boot to ) revent accidental starting . oil level in the crankcase cannot be overemphasized . Check oil before each use : 2 . Remove the oil fill plug / dipstick . 1 . Stop the engine and allow oil to drain into the crankcase . 3 . Pour the oil out of the oil fill hole and into a container by tipping the unit to a vertical position ( Fig . 33 ) . 2 . Place the unit on a flat , level surface to get a proper Allow ample time for complete drainage . oil level reading . 3 . Keep dirt , grass clippings and other debris out of the engine . Clean the area around the oil fill plug / dipstick before removing it . 4 . Remove the oil fill plug / dipstick and wipe off oil . Reinsert it all the way back in . 5 . Remove the oil fill plug / dipstick and check the oil level . Oil should be up to the top of the dipstick ( Fig . 31 ) . Oil Fill Plug / Dipstick \ Fig . 33 Full4 ( 4 . Wipe up any oil residue on the unit and clean up any Add 1.4 - 1.5 Oz . oil that may have spilled . Dispose of the oil ( 41 - 44 ml ) according to Federal , State and local regulations . 5 . Refill the crankcase with 3.4 fluid ounce ( 100 ml ) of SAE 30 SF , SG , SH oil . Top of Dipstick NOTE : Use the bottle and spout saved from initial use to Fig . 31 measure the correct amount of oil . The top of the 6 , If the level is low , add a small amount of oil to the oil label on the bottle measures approximately 3.4 ounces ( 100 ml ) ( Fig . 34 ) . Check the level with the fill hole and recheck ( Fig . 32 ) . Repeat this procedure dipstick . If the level is low , add a small amount of until the oil level reaches the top of the dipstick . oil and recheck . Do not overfill ( Fig . 34 ) . NOTE : Do not overfill the unit . O - Ring i _ Fill Level Oil Fill Plug / Dipstick - Oil Fill Hole J Fig . 32 Fig . 34 NOTE : Make sure the O - ring is in place on the oil fill plug / dipstick when checking and changing the 6 . Replace the oil fill plug / dipstick . oil ( Fig . 32 ) . 7 . Reconnect the spark plug boot . 17
Page: 18

AIR FILTER MAINTENANCE Cleaning the Air Filter Clean and re - oil the air filter every 10 hours of operation . / It is an important item to maintain . Failure to maintain the \ air filter will VOID the warranty . \ \ always turn your trimmer off and allow it to - - - - _ WARNING : fo avoid serious personal injury , / cool before you clean or service it . Fig . 37 Fig . 38 1 . Open the air filter cover . Push the tab on the right side of the cover inward . Then pull the air filter cover 5 . Squeeze the filter to spread and remove excess oil out and to the left ( Fig . 35 ) . ( Fig . 38 ) . NOTE : It may be necessary to remove the fuel cap to 6 . Replace the filter ( Fig . 39 ) . completely remove the air filter cover . NOTE : If the unit is operated without the air filter , you 2 . Remove the air filter ( Fig . 35 ) . will VOID the warranty . Back Plate Back Plate Slot Air Filter / " / Slots Air Filter Cover / _ / _ S Fig . 39 7 . Reinstall the air filter cover . Position the hooks on Tab the left side of the air filter cover into the slots at the left side of the back plate ( Fig . 39 ) . NOTE : It may be necessary to remove the fuel cap to Fig . 35 reinstall the air filter cover . 8 , Swing the cover to the right until the tab on the air 3 . Wash the filter in detergent and water ( Fig . 36 ) . Rinse the filter thoroughly and allow it to dry . filter cover snaps into place in the slot on the back plate ( Fig . 39 ) . 9 . Replace the fuel cap if it was removed . CARBURETOR ADJUSTMENT The idle speed of the engine is adjustable . An idle adjustment screw is reached though a hole in the top of the engine cover ( Fig . 40 ) . NOTE : Careless adjustments can seriously damage your unit . An authorized service dealer should make carburetor adjustments . Check Fuel Old fuel is usually the reason for improper unit performance . Drain and refill the tank with fresh fuel prior Fig . 36 to making any adjustments . Refer to Oil and Fuel Information . 4 , Apply enough clean SAE 30 motor oil to lightly coat the filter ( Fig . 37 ) . 18
Page: 19

Clean Air Filter ROCKER ARM CLEARANCE The condition of the air filter is important to the operation This requires disassembly of the engine . If you feel of the unit . A dirty air filter will restrict air flow . This is unsure or unqualified to perform this , take the unit to an often mistaken for an out of adjustment carburetor . authorized service center . Check the condition of the air filter before adjusting the NOTE : Inspect the valve to rocker arm clearance with a idle speed screw . Refer to Air Filter Maintenance . feeler gauge after the first 10 hours of operation Adjust Idle Speed Screw and then every 25 hours of operation thereafter . • The engine must be cold when checking or adjusting the valve clearance . during idle speed adjustments . Wear protective clothing and observe all safety This task should be performed inside , in a clean , WARNING : The cutting attachment may spin instructions to prevent serious personal injury , dust free area . 1 . Remove the muffler cover by pressing down on it , If , after checking the fuel and cleaning the air filter , the separating it from the engine cover . Using a flat engine still will not idle , adjust the idle speed screw as blade screwdriver , disengage the middle and front follows : tabs and slots first . The cover will hinge off from the 1 , Start the engine and let it run at a high idle for a minute rear tab ( Fig . 41 ) . to warm up . Refer to StaKJng / Stopping Instructions . 2 . Release the throttle trigger and let the engine idle . If the engine stops , inserta small phillips or flat blade screwdriver into the hole in the air filter / muffler cover ( Fig . 40 ) . Turn the idle speed screw in , clockwise , 1 / 8 of a turn at a time ( as needed ) until the engine idles smoothly . NOTE : The cutting attachment should not rotate when Engine Cover the engine idles . 3 , If the cutting attachment rotates when the engine idles , turn the idle speed screw counterclockwise 1 / 8 of a Rear Slot and Tab turn at a time ( as needed ) , to reduce idle speed . Checking the fuel , cleaning the air filter , and adjusting the idle speed should solve most engine problems . If not and all of the following are true : • the engine will not idle • the engine hesitates or stalls on acceleration \ Front Slot / • there is a loss of engine power Have the carburetor adjusted by an authorized service dealer . Fig . 41 injury , make sure the cutting attachment has stopped rotating before you turn it off _ , [ WARNING : TO prevent serious personal 2 , Remove the two ( 2 ) screws on top of the engine cover and set it down . with a Flat - head or T - 25 Torx screwdriver ( Fig . 42 ) , Top View Of The Engine Remove Screws Engine Cover - _ ! Idle Adjustment Screw Fig . 40 Muffler Fig . 42 19
Page: 20

3 . Remove the screw behind the engine cover ( Fig . 43 ) . Adjusting Nuts Rocker Arms INTAKE EXHAUST Feeler Gauge Fig . 43 @ 4 . Disconnect the spark plug wire . 5 . Clean dirt from around the spark plug . Remove the Fig . 45 spark plug from the cylinder head by turning a 5 / 8 in . socket counterclockwise . Adjusting Nut \ 6 . Remove the engine cover ( Fig . 42 ) . Rocker Arm 7 . Clean dirt from around the rocker arm cover . Remove the screw holding the rocker arm cover with a large flat blade screwdriver or Torx T - 25 bit ( Fig . 44 ) . Remove the rocker arm cover and gasket . . 003 - . 006 in , ( . 076 - . 152 Rocker Arm Cover \ \ Valve Stem Spark Plug Hole Fig . 46 10 . If the clearance is not within specification : a . Turn the adjusting nut using a 5 / 16 inch ( 8 mm ) Fig . 44 wrench or nut driver ( Fig . 46 ) . • To increase clearance , turn the adjusting nut 8 . Pull the starter rope slowly to bring the piston to the top counterclockwise . of its travel , ( known as top dead center ) . Check that : • The piston is at the top of its travel while looking in • To decrease clearance , turn the adjusting nut clockwise . the spark plug hole ( Fig . 44 ) Both rocker arms move freely , and both valves are b . Recheck both clearances , and adjust as necessary . closed 11 . Reinstall the rocker arm cover using a new gasket . if these statements are not true , repeat this step . Torque the screw to 20 - 30 indb ( 2.2 - 3.4 N . m ) . 9 . Slide the feeler gauge between the rocker arm and 12 . Reinstall the engine cover . Check alignment of the the valve return spring . Measure the clearance cover before tightening the screws . Tighten screws . between the valve stem and rocker arm ( Fig . 45 ) . Measure both the intake and exhaust valves . 13 . Reinstall the muffler cover . Slip the rear tab on the muffler cover into the engine cover rear slot . Then The recommended clearance for both intake and slide the remaining slots into the tabs until they snap exhaust is . 003 - . 006 in . ( . 076 - 0.152 mm ) . Use a into place ( Fig . 41 ) . standard automotive . 005 in . ( 0.127 mm ) feeler gauge . 14 . Check the spark plug and reinstall . See Replacing The feeler gauge should slide between the rocker arm the Spark Plug . and valve stem with a slight amount of resistance , 15 . without binding . See Figure 45 and 46 . Replace the spark plug wire . 2O
Page: 21

REPLACING THE SPARK PLUG SPARK ARRESTOR MAINTENANCE 1 . Remove the muffler cover . See Rocker Arm Clearance . Use a replacement part number 180852 spark plug . The correct air gap is 0.025 in . ( 0.655 mm . ) . Remove the plug 2 . With a flat blade screwdriver or Torx T - 20 bit , after every 25 hours of operation and check its remove the screw attaching the spark arrestor cover condition . to the muffler ( Fig . 48 ) . 1 . Stop the engine and allow it to cool . Grasp the plug wire firmly and pull the cap from the spark plug . 2 . Clean dirt from around the spark plug . Remove the spark plug from the cylinder headby turning a 5 / 8 in . Muffler Spark Arrestor Screen socket counterclockwise . 3 . Replace cracked , fouled or dirty spark plug . Set the air gap at 0.025 in . ( 0.655 mm . ) using a feeler gauge ( Fig . 47 ) . Slot / Spark Arrestor Cover 0.025 in . ( 0.655 mm . ) Fig . 48 3 , Pull the tab on the spark arrestor cover out of the muffler . Remove the spark arrestor cover . Fig . 47 4 . Remove the spark arrestor screen from the spark arrestor cover . 5 . Clean the spark arrestor screen with a wire brush or clean electrodes . Grit in the engine could CAUTION : Do not sand blast , scrape , or replace it . damage the cylinder . 6 . Reinstall the spark arrestor screen , spark arrestor 4 . Install a correctly - gapped spark plug in the cylinder cover and screw . head . Turn the 5 / 8 in . socket clockwise until snug . If using a torque wrench torque to : 110 - 120 in . , Ib . ( 12.3 - 13.5 N , m ) Do not over tighten . 21
Page: 22

CLEANING NOTE : Remove the spark plug and drain all of the oil from the cylinder before attempting to start the trimmer after storage . always turn your trimmer off and allow it to cool 4 , Change the oil , referring to Changing the Oil . , _ [ WARNING : To avoid serious personal injury , before you clean or do any maintenance on it , Dispose of the old oil in accordance to Federal , State and Local regulations . Use a small brush to clean off the outside of the unit . Do 5 . Thoroughly clean the unit and inspect for any loose not use strong detergents . Household cleaners that or damaged parts . Repair or replace damaged parts contain aromatic oils such as pine and lemon , and and tighten loose screws , nuts or bolts . The unit is solvents such as kerosene , can damage plastic housing ready for storage . or handle . Wipe off any moisture with a soft cloth . TRANSPORTING STORAGE Allow the engine to cool before transporting . • Never store the unit with fuel in the tank where fumes Secure the unit while transporting . may reach an open flame or spark . Drain the gas tank before transporting . • Allow the engine to cool before storing . Tighten gas cap before transporting . • Lock up the unit to prevent unauthorized use or damage . • Store the unit in a dry , well - ventilated area . ACCESSORIES / REPLACEMENT PARTS • Store the unit out of the reach of children . 4 - Cycle Oil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181786 LONG TERM STORAGE Spark Plug . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 180852 Spark Arrestor Screen . . . . . . . . . . . . . . . . . . . . . 180890 1 . Drain all gasoline from the gas tank into a container . Do not use gas that has been stored for more than 60 Replacement Line . . . . . . . . . . . . . . . . . . . . . . . 181472 days . Dispose of the old gasoline in accordance to Replacement Line Cartridge . . . . . . . . . . . . . . . . 181460 Federal , State , and Local regulations . Inner Reel Spring . . . . . . . . . . . . . . . . . . . . . . . . 181465 2 . Start the engine and allow it to run until it stalls . This Bump Knob . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181468 ensures that all gasoline has been drained from the carburetor . Bump Head Assembly . . . . . . . . . . . . . . . . . . . . 181469 Shoulder Strap . . . . . . . . . . . . . . . . . . . . . . . . . . 682075 3 . Allow the engine to cool . Remove the spark plug and put 1 oz . ( 30 ml ) of high quality motor oil into the cylinder . Pull the starter rope slowly to distribute the For a full list of replacement parts , refer to the parts list oil . Reinstall the spark plug . located at the inside back cover of this manual . 22
Page: 23

CAUSE ACTION Turn On / Off control to ON On / Off control in the STOP position Fill fuel tank with new fuel Empty fuel tank Primer bulb wasn't pressed enough Press primer bulb fully and slowly 10 times Old fuel Drain gas tank and add fresh fuel Fouled spark plug Replace or clean the spark plug Plugged spark arrestor Clean or replace spark arrestor CAUSE ACTION Air filter is plugged Replace or clean the air filter Old fuel Drain gas tank and add fresh fuel Improper carburetor adjustment Adjust carburetor CAUSE ACTION Old fuel Drain gas tank and add fresh fuel improper carburetor adjustment Take to an authorized service dealer for adjustment Cutting attachment bound with grass Stop the engine and clean the cutting attachment Dirty air filter Clean or replace the air filter Plugged spark arrestor Clean or replace spark arrestor CAUSE ACTION Old fuel Drain gas tank and add fresh fuel improper carburetor adjustment Take to an authorized service dealer for adjustment Fouled spark plug Replace or clean the spark plug Plugged spark arrestor Clean or replace spark arrestor CAUSE ACTION Cutting attachment bound with grass Stop the engine and clean cutting attachment Refill with new line Cutting attachment out of line inner reel bound up Replace the inner reel Cutting head dirty Clean inner reel and outer spool Line welded Disassemble , remove the welded section and rewind Line twisted when refilled Disassemble and rewind the line Not enough line is exposed Push the bump knob and pull out line until 4 inches ( 102 mm ) of line is outside of the cutting attachment CAUSE ACTION Oil , cleaner or lubricant in cutting head Clean and thoroughly dry the cutting head If further assistance is required , contact your authorized service dealer . 23
Page: 24

Engine Type . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Air - Cooled , 4 - Cycle Displacement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.6 cu . in . ( 26.2 cc ) Clutch Type . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Centrifugal Operating RPM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7,200 - 8,300 rpm Idle Speed RPM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,000 - 4,500 rpm Ignition Type . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Electronic Ignition Switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Rocker Switch Valve clearance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0.003 - 0.006 in . ( . 076 - . 152 mm ) Spark Plug Gap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0.025 inch ( 0.655 mm ) Lubrication . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SAE 30 Oil Crankcase Oil Capacity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.4 oz ( 100 ml ) Fuel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Unleaded Carburetor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Diaphragm , All - Position Starter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Auto Rewind Muffler . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Baffled with Guard Throttle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Manual Spring Return Fuel Tank Capacity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 oz ( 355 ml ) Drive Shaft Housing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Aluminum Tube ( EZ - Link TM ) Throttle Control . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Finger - Tip Trigger Approximate Unit Weight ( No Fuel , with J - handle , cutting attachment and shield ) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Ibs ( 5.5 kg ) Cutting Mechanism . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Dual String Cutting Head Line Spool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bump Line Releaser Line Spool Diameter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 inches ( 76.2 mm ) Trimming Line Diameter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0.080 inches ( 2.03 ram ) Cutting Path Diameter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 in . ( 38.1 cm ) _ AIIspecifications are based on the latest product information available at the time of printing . We reserve the right to make changes at any time without notice . 24
Page: 25

California / EPA Emission Control Warranty Statement Your Warranty Rights and Obligations The California Air Resource Board , the Environmental Protection Agency and MTD LLC ( MTD ) are pleased to explain the emission control system warranty on your 2000 and later small off - road engine . In California and the 49 other states new small off - road engines must be designed , built and equipped to meet stringent anti - smog standards . Ryobi must warrant the emission control system on your small off - road engine for the periods of time listed below provided there has been no abuse , neglect or improper maintenance of your small off - road engine . Your emission control system may include parts such as the carburetor or fuel - injected system , the ignition system , and catalytic converter . Also included may be hoses , belts , connectors and other emission - related assemblies . Where a warrantable condition exists Ryobi will repair your small off - road engine at no cost to you including diagnosis , parts and labor . The 2000 and later small off - road engines are warranted for two years . If any emission - related part on your engine is defective , the part will be repaired or replaced by Ryobi . Owners Warranty Responsibilities • As the small off - road engine owner , you are responsible for the performance of the required maintenance listed in your operator's manual . Ryobi recommends that you retain all receipts covering maintenance on your small off - road engine , but Ryobi cannot deny warranty solely for the lack of receipts or for your failure to ensure the performance of all scheduled maintenance . • As the small off - road engine owner , you however should be aware that Ryobi may deny you warranty coverage if your small off - road engine or a part has failed due to abuse , neglect , improper maintenance or unapproved modifications . • You are responsible for presenting your small off - road engine to a Ryobi Authorized Service Center as soon as a problem exists . The warranty repairs should be completed in a reasonable amount of time , not to exceed 30 days . If you have any questions regarding your warranty rights and responsibilities , you should call 1 - 800 - 345 - 8746 . Manufacturer's Warranty Coverage • The warranty period begins on the date the engine or equipment is delivered to the retail purchaser . • The manufacturer warrants to the initial owner and each subsequent purchaser , that the engine is free from defects in material and workmanship which cause the failure of a warranted part for a period of two years . • Repair or replacement of warranted part will be performed at no charge to the owner at an Authorized Ryobi Service Center . For the nearest location please contact Ryobi at : 1 - 800 - 345 - 8746 . • Any warranted part which is not scheduled for replacement , as required maintenance or which is scheduled for only for regular inspection to the effect of " Repair or Replace as Necessary " is warranted for the warranty period . Any warranted part which is scheduled for replacement as required maintenance will be warranted for the period of time up to the first scheduled replacement point for that part . • The owner will not be charged for diagnostic labor which leads to the determination that a warranted part is defective , if the diagnostic work is performed at an Authorized Ryobi Service Center . • The manufacturer is liable for damages to other engine components caused by the failure of a warranted part still under warranty . • Failures caused by abuse , neglect or improper maintenance are not covered under warranty . • The use of add - on or modified parts can be grounds for disallowing a warranty claim . The manufacturer is not liable to cover failures of warranted parts caused by the use of add - on or modified parts . • In order to file a claim , go to your nearest Authorized Ryobi Service Center . Warranty services or repairs will be provided at all Authorized Ryobi Service Centers . • Any manufacturer approved replacement part may be used in the performance of any warranty maintenance or repair of emission related parts and will be provided without charge to the owner . Any replacement part that is equivalent in performance or durability may be used in non - warranty maintenance or repair and will not reduce the warranty obligations of the manufacturer • The following components are included in the emission related warranty of the engine , air filter , carburetor , primer , fuel lines , fuel pick up / fuel filter , ignition module , spark plug and muffler . 25
Page: 26

ENGINE PARTS - MODELS 825r 4 - CYCLE GAS TRIMMER Part Numbers On Following Page PPN - 41CD825A034 @ - . . - - - / @ @ / / \ \ \ @ E25
Page: 27

ENGINE PARTS - MODELS 825r 4 - CYCLE GAS TRIMMER PPN - 41CD825A034 Item Part NO . Description Item Part NO . Description 1 753 - 1222 Engine Cover 46 791 _ 181247 Pal Nut Retaining Ring 2 79 % 182339 Engine Cover Screws 47 753 - 1199 Recoil Pulley 3 79 % 181025 Valve Cover Screw 48 753 - 1236 Recoil Spring 4 79 % 182098 Valve Cover 49 791 - 182366 Nut Clip 8 79 % 182099 Valve Cover Gasket 50 791 - 181079 Pull Handle 6 791 - 182340 Rocker Adjustment Nut 51 791 - 611061 Rope Guide 7 79 % 182101 Rocker Arm Pivot 52 791 - 613103 Rope 8 79 % 182100 Rocker Arm 53 791 - 181020 Starter Housing Assembly 9 791 _ 182341 Rocker Arm Stud ( includes 4G52 & 54 ) 10 79 % 182103 Valve Spring Retainer 54 753 - 04154 Starter Housing Screw 11 79 % 181038 Valve Spring 55 791 - 182368 Clutch Washer 12 79 % 182102 Push Rod Guide 56 753 - 1238 Clutch with Spacer 13 79 % 181033 Push Rod 57 791 - 153592 Clutch Drum 14 79 % 182653 Cylinder Head Assembly 58 753 - 1239 Clutch Cover 15 791 _ 182344 Cylinder Screw 59 791 - 145569 Anti + RotationScrew 16 753 - 1226 Intake Baffle 60 753 - 1240 Screw 17 791 _ 182749 Carburetor Mount Gasket 61 791 - 181345 Clutch Cover Screw 18 753 - 1232 Muffler Baffle 62 791 - 182725 Ignition Module with Screws 19 79 % 181034 Nut 63 791 - 181065 Spacer 20 79 % 182347 Carburetor Mount ( includes 19 ) 64 791 - 182736 Flywheel 21 791 _ 182348 Carburetor Mount Screw 65 791 - 182743 Shroud Assembly with Screws 22 791 _ 182732 Carburetor Gasket ( includes 86 ) 23 753 - 1225 Carburetor with Primer 66 791 - 182376 Crankcase Assembly 24 791 - 181751 O - Ring , Carburetor 67 791 - 182375 90 Elbow 25 791 _ 182350 Air Filter / Choke Cover Assembly 68 791 - 182379 Breather Hose ( includes 28 & 29 ) 69 791 - 181015 Cam Gear 26 79 % 182097 Breather Tube 70 753 - 1242 Cam Follower 27 79 % 181750 Air Filter Mounting Screw 71 791 - 181013 Cam Bracket 28 79 % 181787 Air Filter 72 791 - 181012 Cam Bracket Screw 29 79 % 182351 Air Filter Cover 73 791 - 181040 Valves , Intake and Exhaust 30 79 % 182271 Fuel Cap 74 791 - 182374 Cylinder Gasket 31 79 % 182382 Fuel Return Line 75 791 - 181018 Oil Pan Gasket 32 791 - 182353 Fuel Pick - Up Line with Filter 76 791 - 182377 Oil Pan ( includes 75 & 77 ) 33 79 % 181080 Screw 77 791 - 181020 Oil Pan Screw 34 79 % 182384 Washer 78 791 - 182378 Dipstick Assembly ( includes 79 ) 38 791 _ 182355 Fuel Tank Assembly ( includes 30 - 32 ) 79 791 - 182290 O _ Ring 36 791 _ 182356 Fuel Tank Shield 80 791 - 181009 Conn _ ' cting Rod 37 753 - 1231 Throttle Cable 81 791 - 181008 Wrist Pin Button 38 79 % 181048 Muffler Gasket 82 753 - 1243 Piston 39 79 % 182389 Muffler ( includes 40 , 42 * 44 ) 83 791 - 181006 Wrist Pin 40 79 % 180890 Spark Arrestor Screen 84 791 - 181005 Piston Ring Set 41 79 % 181045 Screen Cover 85 791 - 182409 Washer 42 79 % 181046 Screw 86 791 - 181861 Screw 43 791 _ 182361 Muffler Mounting Screw 87 791 - 182365 Ignition Switch Assembly w / Leads 44 753 - 04092 Muffler Cover 791 _ 180852B Spark Plug 48 753q241 Nut 753 _ 04087 Short Block Assembly ( includes 3 _ 15 , & 66 - 84 ) 791 - 180142 Starter Pawl Repair Kit 753 - 04014 Carburetor Repair Kit 791 _ 182745 Cylinder Assembly ( includes 9 , 12 , 14 , 74 ) Parts not shown E26
Page: 28

- - BOOM AND TRIMMER PARTS - MODEL 825r 4 - CYCLE GAS TRIMMER PPN - 41CD825A034 @ Item Part NO _ Descri # tion 1 791 _ 182808 Throttle Housing & Trigger Assembly ( includes 2 & 3 ) 2 791 - 610314 Throttle Trigger Spring 3 791d82385 Throttle Trigger 4 753d231 Throttle Cable Assembly 5 753 - 1247 Upper Drive Shaft Housing Assembly 6 791 - 180687 J - Handle Assembly ( includes 7 & 8 ) 7 791 - 612831 Grip 8 791 - 612021 Tube Closure 9 791 - 683295 Handle Bracket Assembly ( includes 10 - 15 ) 10 791 - 181811 Screw 11 791 - 181812 Upper Handle Clamp 12 791 - 181813 Middle Handle Clamp 13 791 - 181814 Lower Handle Clamp 14 791 - 181815 Nut 15 791 - 145569 Anti - Rotation Screw 16 791 - 1816168 Click _ Link Coupler ( includes 17 _ 20 ) 17 791 - 182057 Screw 18 791 - 181617 Bolt 19 791 - 1816188 Adjustment Knob 20 791 - 181886 Knob Retaining Nut 21 791 - 182387 Lower Drive Shaft Housing Assembly 22 791 - 153597 Lower Clamp Assembly 23 791 - 181852 Lower Flexible Drive Shaft 24 791 - 180531 Shield Mounting Screw 25 791 - 181857 Bushing Housing Assembly 26 791 - 145569 Anti - Rotation Screw 27 791 - 683274 Shield and Blade Assembly ( includes 28 ) 28 791 - 682061 Blade Assembly 29 791 - 181457 Outer Spool and Eyelet Assembly w / Retainer 30 791 - 181458 Retainer 31 791 - 181561 Thrust Washer 32 791 - 181459 Small Spring 33 791 - 181461 Slider 34 791 - 181532 E _ Clip 35 791 - 181531 Spring 36 791 - 181462 Plunger 37 791 - 181463 C - Clip 38 791 - 181464 Inner Reel 39 791 - 1814658 Large Spring 40 791 - 181467 Foam Seal 41 791 - 1814688 Bump Head Knob Assembly w / Spring & Foam Seal 791 + 610327 Harness Clip ( Used with Version B Grip ) Items Not Shown E27
Page: 29

MANUFACTURER'S LIMITED WARRANTY FOR : RYOBI , The limited warranty set forth below is given by MTD LLC No implied warranty , including any implied warranty of ( " MTD " ) with respect with new merchandise purchased and merchantability or fitness for a particular purpose , used in the United States , its possessions and territories . applies after the applicable period of express written warranty above as to the parts as identified . No other MTD warrants this product against defects in material and express warranty or guaranty , whether written or oral , workmanship for a period of two ( 2 ) years commencing on the except as mentioned above , given by any person or date of original purchase and will , at its option , repair or entity , including a dealer or retailer , with respect to any replace , free of charge , any part found to be defective in product shall bind MTD . During the period of the material or workmanship , This limited warranty shall only Warranty , the exclusive remedy is repair or replacement apply if this product has been operated and maintained in of the product as set forth above . ( Some states do not accordance with the Operator's Manual furnished with the allow limitations on how long an implied warranty lasts , so product , and has not been subject to misuse , abuse , the above limitation may not apply to you . ) commercial use , neglect , accident , improper maintenance , alteration , vandalism , theft , fire , water or damage because of The provisions as set forth in this Warranty provide the other peril or natural disaster , Damage resulting from the sole and exclusive remedy arising from the sales . MTD installation or use of any accessory or attachment not shall not be liable for incidental or consequential loss or approved by MTD for use with the product ( s ) covered by this damages including , without limitation , expenses manual will void your warranty as to any resulting damage , incurred for substitute or replacement lawn care services , for transportation or for related expenses , or This warranty is limited to ninety ( 90 ) days from the date of for rental expenses to temporarily replace a warranted original retail purchase for any MTD product that is used for product . ( Some states do not allow limitations on how long rental or commercial purposes , or any other income - an implied warranty lasts , so the above limitation may not producing purpose , apply to you . ) HOW TO OBTAIN SERVICE : Warranty service is available , In no event shall recovery of any kind be greater than the WITH PROOF OF PURCHASE THROUGH YOUR LOCAL amount of the purchase price of the product sold . AUTHORIZED SERVICE DEALER , To locate the dealer in your Alteration of the safety features of the product shall void area , please check for a listing in the Yellow Pages or contact this Warranty . You assume the risk and liability for loss , the Customer Service Department of MTD LLC by calling damage , or injury to you and your property and / or to 1 - 800 - 345 _ 8746 or writing to P . O . Box 361131 , Cleveland others and their property arising out of the use or misuse or OH 44136 - 0019 or if in Canada call 1 - 800 - 668 _ 1238 . No inability to use the product . product returned directly to the factory will be accepted unless prior written permission has been extended by the This limited warranty shall not extend to anyone other than Customer ServiceDepartmentof MTD LLC . the original purchaser , original lessee or the person for whom it was purchased as a gift . This limited warranty does not provide coverage in the following cases : How State Law Relates to this Warranty : This warranty gives you specific legal rights , and you may also have other A . Tune - ups - Spark Plugs , Carburetor Adjustments , rights which vary from state to state . Filters To locate your nearest service dealer dial 1 - 800 _ 345 - 8746 B . Wear items - Bump Knobs , Outer Spools , Cutting Line , in the United States or 1 - 800 - 668 - 1238 in Canada . Inner Reels , Starter Pulley , Starter Ropes , Drive Belts C . MTD does not extend any warranty for products sold or exported outside of the United States of America , its MTD LLC possessions and territories , except those sold through MTD's authorized channels of export distribution . RO . Box 361131 MTD reserves the right to change or improve the design of Cleveland , OH 44136 - 0019 any RYOBI Product without assuming any obligation to modify any product previously manufactured . SAVE THESE INSTRUCTIONS FOR FUTURE REFERENCE . FOR QUESTIONS CALL 1 - 800 - 345 - 8746 IN U . S . OR 1 - 800 - 668 - 1238 IN CANADA OPERATOR'S MANUAL PART NO . 769 - 00557 1 / 03 PRINTED IN U . S . A .
Search in WeedWacker_Weed-Trimmer on ebay
"