Register / log-in to add to your Hammerwall Collection.
Manual Location

The Search Results for the Search Section to the left will appear here.

Upload a pic of this item

Manuals For Same Model Number.
No other Manuals with the Exact Same Model Number and Manufacture.

---

Other Items that are in the Same Category.
028 STIHL Chain Saw...

Page: 1

Important Safety Precautions for Chain Saw Usem A . Kickback Safety Precautions 2 , Keep a good firm grip on the saw with both hands , the right hand on the rear handle , and the left hand Warning ! on the front handle , when the engine is running . Kickback may occur when the nose or tip of the guide Use a firm grip with thumbs and fingers encircling bar touches an object , or when the wood closes in and the chain saw handles , A firm gr : p will help you re = pinches the saw chain in the cut . Tip contact in some duce kickback and maintain control of the saw . cases may cause a lightning fast reverse reaction , Don't let go kicking the guide bar up and back towards the 3 . Make sure that area in which you are cutting is free operat0r _ Pinching the saw chain along the top of the from obstructions . Do not let the nose of the guide bar guide bar may push the guide bar rapidly back to - contact a log , branch , or any other obstruction wards the operator : Either of these reactions may which could be hit while you are operating the saw . cause you to ! ose control of the saw which could re - sult in serious personal injury . 4 = Cut at high engine speeds . 5 . Do not overreach or cut above shoulder height . Section 4 _ 12of ANSI B 175 . ! - 1985 sets ce _ ain perfor - 6 . Follow manufacturer's sharpening and mainten - mance and design cdteria related tochain saw kickback . ance instructions for the saw chain . STIHL has developed a color code system using green and yellow to help you select a powerhead , bar 7 Only use replacement bars and chains specified and chain combination that complies with the kickback by the manufacturer or the equivalent . requirements of the ANS ! Standard . See the sections entitled " Safety Precautions1 ' and " Specifications , of this Manual . B = Other Safety Precautions 1 . Do not rely exclusively upon the safety devices built in - Do not operate a chain saw when you are fatigued . to your saw . As a chain saw user , you should take 2 . Use safety footwear : snug - fitting clothing ; protec - several steps to keep your cutting jobs free from acci - tive gloves ; and eye , hearing , and head protection dent or injury . devices . Use caution when handling fuel , Move the chain 1 . With a basic understanding of kickback , you can reduce or eliminate the element of surpdse . Sud - saw at least 10 feet ( 3 m ) from the fueling point before starting the engine . den surprise contributes to accidents . continued on the back inside cover - - _
Page: 2

STIHL 028 AV electronic Ouickstop Wood Boss , 028 AMSuper electronic Quickstop Operating Instructions ThisManuaclontainosperatinagndsafetyinstructions Sharpening and Maintenance of Saw Chains foral ! STIH0L28seriespowesraws . Contents Payspeciaalttentiotnothesafetyprecautionosutlined ontheinsidecovear ndonpages4to23 . Allowonlyper - 2 Parts of the Chain Saw sonswhounderstanthdisManuatol operatyeourchain 4 Safety Precautions SaWn 4 - The Operator 6 - The Saw To receive maximum performance and satisfaction from 6 - The Use of the Saw your STIHL chain saw , it is important that you read and 23 - Maintaining and Storing the Saw understand the maintenance and safety precautions be - 24 Fuel fore using your saw . Contact your STIHL dealer or the 25 Chain Oil STIHL distributor for your area ff you do not understand 26 Mounting the Bar and Chain any of the instructions in this Manual . 28 Tensioning the Saw Chain 29 Chain Brake 30 General Notes on Operation 31 Master Control Warning ! 32 Starting 34 Electric Handle Heating Because a chain saw is a high - speed wood - cutting tool , 35 Intake . Air Preheating some special safety precautions must be observed as 36 Guide Bar . Chain and Sprocket with any other power saw to reduce the risk of persona 38 Air Filter injury . Careless or improper use may cause serious or 39 Carburetor even fatal injury . 41 Replacing the Chain Sprocket 43 Rewind Starter STIHL's philosophy is to continually improve all of its pro - 45 Maintenance Chart ducts . As a result , engineering changes and improve - 46 ments are made from time - to - time . If the operating Specifications 47 charactedstics or the appearance o ! your saw differs Sharpening and Maintenance of Saw Chains 53 Ordering Spare Parts from those described in this Manual , please contact you r 54 Key to Symbols STIHL dealer for information and assistance . ® Andreas Stih ! Postfach1771 0458 ti8 3021 = M8 C9 , Rei P6nted in West Germany X < i : _ And [ eas Stthi 1985
Page: 3

Parts of the Chain Saw Front hand guard 6 7 Front handle Chain brake 5 8 Spark plug terminal Bumper spike 4 Guide bar nose 3 Guide bar 2 9 Handle heating switch Oilomatic saw chain ! Chain catcher 12 10 Rear handle Chain sprocket 13 Chain sprocket cover 14 11 Rear hand guard _ , " \ - - , 19 Chain guard 20 Muffler Twist lock 15 2 ! Starter grip Throttle trigger interlock ! 6 22 Oil filler cap Throttle trigger 17 Master Control lever 18 23 Fuel filler cap 2
Page: 4

13 . Chain Sprocket . The toothed wheel that drives the Definitions saw chain , 10ilomaticSaw Chain . A loop of chain having cutters . 14 . Chain Sprocket Cover . Covers the clutch and the tie straps and drive links . sprocket , 2 . Guide Bar . Supports and guides the saw chain 15 . Twist Locl £ Lock for carburetor box cover , 3 . Guide Bar Nose . The exposed end of the g uide bar 16 . Throttle Trigger Interlock . Must be depressed be - fore the throttle trigger can be activated . 4 . Bumper Spike . Toothed stop for holding saw steady against wood . 17 . Throttle Trigger . Controls the speea of the engine . 5 _ Chain Brake . A device to stop the rotation of the 18 , MasterControlLever . Leverforchoke control start - chain if activated in a kickback situation by the ope - _ ng throttle , run and stop switch position rator's hand or by inertia . 19 . Chain Guard ( Scabbard ) , Covers the bar and the 6 . Front Hand Guard . Provides protection against pro - chain when the saw _ snot in use jecting branches and helps prevent the left hand from touching the chain if it slips off the handle bar , 20 . Muffler . Reduces engine exhaust noise and directs the exhaust gases , 7 . Front Handle . Handle bar for the left hand at front of SaW . 21 . Starter Grip , The grip of the starter for starting the engine . 8 . Spark Plug Terminal . Connects the spark plug with the ignition wire . 22 . Oil Filler Cap . For clostng tl _ e oil tank , 9 Handle Heating Switch . For switching the electric 23 . Fuel Filler Cap . For closing the fuel tank handle heating on aria off , Clutch , Couples engine to chain sprocket when I0 . Rear Handle . The support handle forthe right hand , Located at or toward the rear of the saw , engine is accelerated beyond idle speed , ( not illustrated ) 11 Rear Hand Guard , Gives added protection to opera - tor's right hand . 12 . Chain Catcher . Helps to reduce the risk of operator contact by a chain when it breaks or comes off the 3 bar
Page: 5

Safety Precautions The use of any chain saw may be hazardous . The saw chain has many sharp cutters . If the cutters contact your flesh , they will cut you , even if the chain is not moving . At full throttle , the chain speed can reach 45 mph ( 20 m / s ) . It is important that you read , fully understand and observe the following safety precautions and warnings . Read the owner's manual and the safety instructions periodically . Pay special attention to the section on reactive forces , pages 10to 16 . Reactive forces , including kickback , can be dangerous . Careless or improper use of any chain saw may cause These safety precautions and warnings apply to the use of serious or fatal injury . all STIHL chain saws . Different models may have different parts and controls . See the appropriate section of your Ail safety precautions that are generally observed when Owner's Manual for a description of the controls and working with an axe or a hand saw also apply to the opera - function of the parts of your model saw . tion of chain saws . However , because a chain saw is a Safe use of a chain saw involves highspeed , fast - cutting power tool , special safety pre - cautions must be observed to reduce the risk of personal injury . 1 . the operator 2 . the saw 3 . the use of the saw . Have your STIHL dealer show you how to operate your chain saw . Observe all applicable local safety regulations , standards and ordinances . THE OPERATOR Minors should never be allowed to use a chain saw . Bystanders , especially children and animals should not be Physical Condition allowed in the area where a chain saw is in use ( ill . 1 ) _ You must be in good physical condition and mental health Never let the saw run unattended . Store it in a locked place and not under the influence of any substance ( drugs , away from children and empty the fuel tank before storing alcohol ) which might impair vision , dexterity or judgment . for longer than a few days . Do net operate a chain saw when you are fatigued ( ill . 2 ) , Do not lend or rent your chain saw without the Owner's Be alert - If you get tired while operating your chain saw , Manual . Be sure that anyone using your saw reads and take a break . Tiredness may result in loss of control . Work - understands the information contained in this Manual . ing with any chain saw can be strenuous . If you have any
Page: 6

conditiotnhatmightbeaggravatebdystrenuouwsork , checkwithyourdoctobreforeoperatinagchainsaw . Prolongeudseofchainsaws ( orothemr achineesx ) posing theoperatotor vibrationmsayproducwehitefingedris - ease ( Raynaudp'shenomenoTnh ) . isphenomenoren - ducetshehand'sabilitytofeelandregulatteemperature , producensumbnesasndburningsensationasndmay causenerveandcirculatiodnamagaendtissuenecrosis . ManySTIHLmodelsareavailablweithananti - vibration ( AVs ) ystemdesignetdoreduceenginveibrationA . nanti - Proper Clothing vibratiosnystemis recommendfeodrthoseusingchain sawsonaregulaorrsustainebdasis . Clothing must be sturdy and snug - fitting , but allow com - plete freedom of movement . Avoid loose - fitting jackets , Heatedhandleshelpto reducetheriskof whitefinger diseasaendarerecommendfoerdcoldweatheurseM . ost scarfs , neckties , jewelry , flared or cuffed pants , or anything that could become entangled with the saw or brush . Wear STIHLpowerheaadrseavailabwleithheatehdandles . overalls or jeans with a reinforced cut resistant insert ( ill . 3 ) . Antiwibratiosnystemasndheatedhandledsonotgua - ranteethatyouwiflnotsustaiwnhitefingdeirseaseT . here - Protect your hands with gloves when handling saw and fore , continuaalndregulaursersshouldmonitocrlosely theconditioonftheirhandasndfingersIf . anyoftheabove saw chain . Heavy - duty , nonslip gloves improve your grip 5 and protect your hands . symptomasppeasr , eekmedicaaldviciemmediately .
Page: 7

Good footing is most important in chain saw work . Wear sturdy boots with nonslip soles . Steel - toed safety boots are recommended . Proper eye protection is a must . Non - fogging , vented goggles or a face screen is recommended . Their use re - duces the risk of eye injury . Wear an approved safety hard hat to protect your head . Chain saw noise may damage your hearing . Always wear sound barriers ( ear plugs or ear mufflers ) to protect your hearing . Continual and regular users should have their hearing checked regularly . the powerhead muffler and the material around it reach extremely high temperatures . Avoid touching the hot THE SAW muffler , you could receive serious burns . Parts of the chain saw ; for illustrations and definitions of By hand : When carrying your saw by hand , the engine must be stopped and the saw must be in the proper posi - the parts see pages 2 and 3 ! tion . Grip the front handle and place the muffler away from Wamin _ : jt the body ( ill . 4 ) . Never modify a chain saw in any way . Only attachments The chain guard ( scabbard ) should be over the chain and and parts supplied by STIHL or expressly approved by the guide bar , which should point backwards . When carry - STIHL for use with the specific STIHL saw models are ing your saw , the bar should be behind you ( ill 4 ) . authorized . Although certain unauthorized attachments are useable with the STIHL powerhead , their use may , in fact , By vehicle ; When transporting in a vehicle , keep chain be extremely dangerous . and bar covered with the chain guard , Properly secure your saw to prevent turnover , fuel spillage and damage to THE USE OF THE SAW the saw . Transporting the chain saw Preparation for the use of the saw Take off the chain guard and inspect for safety in operation . Always stop the engine before putting a chain saw down or For assembly , follow the procedure described in carrying it , Carrying a chain saw with the engine running the section entitled " Mounting the Bar and Chain " of your is extremely dangerous . Accidental acceleration of the 6 Owner's Manual . engine can cause the chain to rotate . During operation ,
Page: 8

STIHOLilomatcichaing , uidebarandsprockemtusmt atch eachotheirngaugeandpitch . Beforereplacinagnybarandchains , eethesectionosn " Specificationsk " i , ckbacakndtheANSIB 175.1 - 1985 chainsawkickbacsktandaridnthisManual . W _ rnin ! g Propeter nsioonfthechainisextremeilmy portanInt . order 5 toavoidimpropesrettingth , etensioninpgrocedurmeust befollowedasdescribeidnyourManuaAl . lwaysmake surethehexagonnaul t ( s ) forthesprockectoveris ( are ) Always shut off the engine and allow it to cool before tightenesdecurelayftertensioninthgechainN . evesrtart refueling . Relieve fuel tank pressure by loosening fuel cap thesawwiththesprockecot veIrooseC . hecckhaintension slowly . oncemoreafterhavingtightenetdhenut ( sa ) ndthere - afteratregulairnterval ( swhenevtehresawisshutoff ) . tf Select bare ground for fueling and move at least 10 feet thechainbecomelososewhilecuttings , hutofftheengine ( 3 m ) from fueling spot before starting the engine . Wipe andthentightenN . evetrrytotightenthechainwhilethe off any spilled fuel before starting your saw , and check enginiesrunning ! for leakage . Check for fuel leakage while refueling and during ope - Fueling ration . If fuel or oil leakage is found , do not start or run the engine until leak is fixed and spilled fuel has been wiped YouSr TIHcLhainsawusesanoil - gasolinmeixturfeorfuel away . Tighten the fuel cap after filling to avoid spillage and risk of fire . ( seechapteerntitled " Fuel " ofyourOwner'Ms anual ) . Wam { _ ! g Gasolinies anextremelfylammabfleuel . Useextreme Starting cautiown henhandlinggasolinoerfuelmix . Donotsmoke orbringanyfireorflamenearthefuel ( ill . 5 ) . Wamir _ g _ Your chain saw is a one - person saw . Do not allow other persons to be near the running chain saw . Start and FuelingInstructions operate your saw without assistance . For specific starting instructions , see the appropriate section of the Owner's Fuel your chain saw in well - ventilated areas , outdoors Manual . Proper starting methods reduce the risk of in - 7 only . jury ,
Page: 9

Be sure that the guide bar and chain are clear of you and all other obstructions and objects , including the ground . When the engine is started , the engine speed with the star - ting throttle lock engaged wiil be fast enough for the clutch to engage the sprocket and turn the chain . If the upper quadrant of the tip of the bar touches any object , it may cause kickback to occur ( see section on reactive forces on pp . 10 - 16 ) . To reduce this risk , always engage the chain brake before starting . Never attempt to start the chain saw when the guide bar is in a cut or kerf , Do not drop start . This method is very dangerous because you may lose control of the saw ( ilL6 ) , When you pull the starter grip , do not wrap the starting rope around your hands , Do not allow the grip to snap There are two recommended methods for starting your back , but guide the starter rope slowly back to permit the chain saw . With the first method , the chain saw is started rope to rewind properly . Failure to follow this procedure on the ground . Engage the chain brake ( see " Chain Brake " may result in injury to hand or fingers and may damage the starter mechanism . chapter in your Owner's Manual ) and place the chain saw on firm ground or other solid surface in an open area . Maintain good balance and secure footing . Grip the front handlebar of the saw firmly with your left hand and press down , For saws with a rear handle level with the ground , put the toe of your right foot into the rear handle and press Important adjustments down . With your right hand pull out the starter grip slowly until you feel a definite resistance and then give it a brisk , strong pull . Wami _ g _ At correct idle speed , the chain should not rotate . For di - The second recommended method for starting your rections to adjust idle speed , see the appropriate section chain saw allows you to start the saw without placing it on of this Owner's Manual . the ground , Engage the chain brake , grip the front handle of the chain saw firmly with your left hand . Keep the arm on the front handle in a locked ( straight ) position . Hold the Do not use a saw with incorrect idle speed adjustment . rear handle of the saw tightly between your tegs just above the knees , Maintain good balance and secure footing . Pull If you cannot set the correct idle speed , have your STIHL dealer check your saw and make proper adjustments or the starting grip slowly with your right hand until you feel a 8 definite resistance and then give it a brisk , strong pull . repairs .
Page: 10

Aftear djustinagchains , tartthesawl , ettheenginreunfor awhilet , henswitchenginoeffandrechecckhaintension . Propecrhaintensioinsveryimportanattalltimes . Working Conditions Operate your chain saw only outdoors in a ventilated area . Operate the saw under good visibility and daylight condi - 7 tions only . Wrap your fingers tightly around the handles , keeping the Don't work alone , Keep within calling distance of others in handles cradled between your thumb and forefinger ( il ! , 7 ) . case help is needed . With your hands in this position , your can best oppose and absorb the push , pull and kickback forces of your saw without losing control ( see section on reactive forces ) , Warning ! Make sure your chain saw handles and grip are in good Take extreme care in wet and freezing weather ( rain , snow , condition and free of moisture , pitch , oil or grease . ice ) . Put off the work when the weather is windy , stormy or rainfall is heavy , Clear the area where your are working , Warning ! Never use the saw with one hand . You cannot control reac - Warning ! tive forces ( see pages 10 to 16 ) and may lose control of the Avoid stumbling on obstacles such as stumps , roots or saw . rocks and watch out for holes or ditches . Be extremely cautious when working on slopes or uneven ground . There is increased danger of slipping on freshly debarked logs , Even for those compact saws designed for use in confined spaces , one - handed operation is dangerous because the operator may lose control , Cutting Instructions Warning ! Do not operate your chain saw with the starting throttle Grip : Always hold the saw firmly with both hands when the lock engaged . Cutting with the starting throttle lock enga - engine is running . Place your left hand on front handle bar ged does not permit the operator proper control of the and your right hand on rear handle and throttle trigger . 9 saw or chain speed . Left - handers should follow this instructions too ,
Page: 11

When sawing , make sure that the saw chain does not touch any foreign materials such as rocks , fences , nails and the _ ike ( ill . 8 ) . Such objects may be flung off , damage the saw chain or cause the saw to kick back . In order to keep control of your sav ¢ , always maintain a firm foothold , Never work on a ladder , in a tree or on any other insecure support , Never use the saw above shoulder height ( ill . 9 ) . Position the chain saw in such a way that your body is clear of the cutting attachment whenever the engine is run - ning . Stand to the left of cut while bucking ( see ill . 10 ) . Warnin ! ! Never touch a chain with your hand or any part of your Don't put pressure on the saw when reaching the end of a body when the engine is running , even when the chain is cut . The pressure may cause the bar and rotating chain to not rotating . The chain continues to rotate for a short pe - pop out of the cut or kerf , go out of control and strike the riod after the throttle trigger is released . operator or some other object . If the rotating chain strikes some other object , a reactive force ( see pages 10 to ! 6 ) Warnin ! ! may cause the moving chain to strike the operator . Do not cut any material other than wood or wooden ob - jects . Reactive forces including kickback Use your chain saw for cutting only , It is not designed for Wamb _ g ! 10 prying or shoveling away limbs , roots or other objects . Reactive forces may occur any time the chain is rotating ,
Page: 12

Reactives forces can be dangerous ! In any chain saw , the powerful force used to cut wood can be reversed ( and work against the operator ) . If the rotating chain is suddenly stopped by contact with any solid object like a log or branch or is pinched , the reac - tive forces may occur instantly . These reactive forces may result in loss of control which may , in turn , cause serious or fatal injury . An understanding of the causes of these re - active forces may help you avoid loss of control . The most common reactive forces are - kickback , - pushback , - pull - in . Kickback : Kickback occurs when the upper quadrant of the bar nose contacts a solid object or is pinched ( ill . 11 ) . The reaction of the cutting force of the chain causes a rotational force on the chain saw in the direction opposite to the chain mo - vement . This may fling the bar up and back in an uncon - trolled arc mainly in the plane of the bar . Under some cut - ting circumstances the bar moves towards the operator , who may suffer servere or fatal injury . Kickback may occur The type of bar and saw chain you use is an important fac - when the nose of the guide bar is pinched unexpectedly , tor in the occurrence and force of the kickback reaction . unintentionally contacts solid material in the wood , ( ill . 12 ) Some STIHL bar and chain types are designed to reduce or is incorrectly used to begin a plunge or boring cuL It kickback forces . STIHL recommends the use of reduced may also occur during limbing . kickback bars and low kickback chains . The greater the force of the kickback reaction , the more difficult it becomes for the operator to control the saw . ANSI B 175.1 - 1985 chain saw kickback standard Many factors influence the occurrence and force of the Section 4.12 of ANSI standard B 175 _ 1 - 1985 , sets certain kickback reaction . These include chain speed , the speed performance and design criteria related to chain saw kick - at which the bar and chain contact the object , the angle of 11 back . contact , the condition of the chain and other factors .
Page: 13

To comply with section 4.12 of ANSI B 175.1 - 1985 : - bar and chain combinations listed as complying in the " Specifications " section of the Owner's Manual or a ) saws with a displacement of less than 3.8 cubic inches - other replacement bar and chain combinations marked in accordance with the standard for use on the power - head or - must , in their original condition , meet a 45 ° computer derived kickback angle when equipped with certain - replacement chain designated " low kickback saw chain ' , 1 ) cutting attachments described on page 12 , - and must be equipped with at least two devices to re - Wam # _ g ! There are potential powerhead and bar combi _ duce the risk of kickback injury , such as a chain brake , nations with which low kickback saw chains can be used low kickback chain , reduced kickback bar , etc , which have not been specifically certified to comply with b ) saws with a displacement of 3.8 cubic inches and the 45 ° computer derived kickback angle of § 4.12 of ANSI B 175.1 - 1985 . Some low kickback chains have not been above tested with all powerhead and bar combinations . - must be equipped with at least one device designed STIHL offers a variety of bars and chains , STIHL reduced kickback bars and tow kickback chains are designed to re - to reduce the risk of kickback injury such as a chain brake , low kickback chain , reduced kickback bar , etc . duce the risk of kickback injury . Other chains are designed to obtain higher cutting efficiency or sharpening ease but may result in higher kickback tendency . These kickback requirements do not apply to chain saws fitted with bow guides . Bow - equipped saws are only for STIHL has developed a color code system to help you use by thoroughly instructed and experienced operators . Use of bow guides may result in serious or fatal injury . See identify the STIHL reduced kickback bars and low kick - section entitled " Bow Guides " of this Manual . back chains , Cutting attachments with green warning de _ cals or green labels on the packaging are designed to re - The computer derived angles for saws below 3.8 cubic inch displacement are measured by applying a computer duce the risk of kickback injury . The matching of green de - caled powerheads under 3.8 cubic inch displacement with program to test results from a kickback test machine . Warn n _ ! green labeled bars and green labeled chains gives com - pliance with the computed kickback angle requirements of The computer derived angles of § 4.12 of ANSi B 175.1 - ANSI B 175.1 - ! 985 when the products are in their original 1985 may bear no re { ationehip to actual kickback bar mta _ condition , Products with yellow decals or labels are for tion angles that may occur in real life cutting situations . users with extraordinary cutting needs and experience Compliance with § 4.12 of ANSI B 175.1 - 1985 does not au - tomatically mean that in a real life kickback the bar and _ / " Low kickback saw chain " is a chain which has met the chain will rotate at most 45 ° , kickback performance requirements of § 4,12.2.4 of ANSI B 175.1 - 1985 ( Safety Requirements for Gasoline - Powered In order for powerheads below 3.8 cubic inch dieplace _ ment to comply with the computed kickback angle re * Chain Saws ) when tested on a selected representative sample of chain saws below 3.8 cubic inch displacement quirements of § 4,12 of ANSI B 175,1 - 1985 use only the 12 following cutting attachments : specified in ANSI B 175.1 - t985 .
Page: 14

andspecializterdaininfgordealinwgithkickback . Guard STIHL recommends the use of its green labeled redu - ced kickback bars , green labeled low kickback chains and a STIHL Quickstop chain brake for both experien - ced and inexperienced chain saw users . Please ask your STIHL dealer to properly match your po - werhead with the appropriate bar / chain combinations to reduce the risk of kickback injury . Green labeled bars and t3 Guard Spurs chains are recommended for all powerheads . See your " STIHL Bar and Chain Information " leaflet for details _ Only STIHL bow guides are approved for use with STIHL Warning ! Use of other , non - listed bar / chain combinations powerheads . The use of other bow guides with a STIHL may increase kickback forces and increase the risk of kick - powerhead can be hazardous to the operator due to the back injury . absence of safety guards and spurs and necessary un - New bar / chain combinations may be developed after pu - authorized modifications needed to mount the bow guide blication of this literature , which will , in combination with to the STIHL powerhead . certain powerheads , comply with § 4.12 of ANSI B 175.1 - 1985 . Check with your STIHL dealer for such combina - Do not use a STIHL bow guide on any powerhead except tions . a STIHL powerhead . Unauthorized combinations are dan - gerous . Bow Guides Warning ! Any chain saw equipped with a bow guide is po . - tentially very dangerous , improper _ Jsecarl resL _ Itin kicb Warnfng ! back pushback or pull4n , and very serious injury or death . Never attempt to operate a chain saw equipped with a Only thoroughly instructed and experienced operators bow guide unless the spurs and both guards are in place should use a chain saw equipped with a bow guide ( ill . 13 ) . Under no circumstances should any of the spurs or A bow guide ( or bow bar ) is a specially designed substitu - guards be removed . Keep the nuts which hold these items tion for a regular guide bar . Like a regular guide bar , it in place tightened at all times . supports and guides the saw chain . Unlike a regular guide bar , it consists of a narrow rail structure with a large open The guards at the top and bottom of the bow guide are re - space in the middle , quired to reduce the possibility of injury caused by contact Warning ! The risk of kickback is increased with a bow with the chain . These guards are slotted to allow position - guide because of the increased kickback contact area . ing as close to the powerhead as possible . After the bow STIHL recommends the use of the STIHL Quickstop chain guide is mounted on the chain saw , slide the guards as brake , Low kickback chain will not significantly reduce 13 close to the powerhead as possible . the risk of kickback injury when used on a bow guide .
Page: 15

Quickstop chain brake The spurs should always be placed firmly against the wood before starting a cut ( ill . 14 ) and should be kept STIHL has developed a chain stopping system designed to reduce the risk of injury in certain kickback situations . It against the wood until the cut is completed . Failure to keep the spurs firmly against the wood during the entire is called a Quickstop chain brake . The Quickstop is availa - cut could cause the saw to react violently and could result ble as standard equipment on your STIHL chain saw and is available for installation on most older STIHL saws . Ask in serious injury or death to the operator . your dealer to retrofit your older model saw with a chain brake . Be sure to keep the chain properly tensioned . A chain When a kickback occurs , the guide bar may rotate around which " sags " or is too loose could jump off the bow and result in serious injury to the operator . Felling with a bow the front handle . If the cutting position is such that the operator's left hand is gripping the front handle behind the bar is dangerous , because it is more difficult to follow safe hand guard , and it the left hand rotates around the front felling techniques . handle and contacts the front hand guard , which is the Quickstop activating lever , this contact will activate the Cut only one log at a time . Quickstop ( see ill . 15 ) , The chain brake on most new model A chain catcher which has been removed to allow mount _ STIHL chain saws can also be activated by inertia , See the chapter entitled " Chain Brake " of your Owner's Manual . ing of a bow guide must be reattached when remounting the regular guide bar . Warning ! Devices for reducing the risk of kickback injury Never operate your chain saw without a front hand guard , In a kickback situation this guard helps protect your left STIHL recommends the use of the STIHL Quickstop chain hand or other parts of your body _ In addition , removal of the hand guard on a saw equipped with a chain brake will brake on your powerhead with green labeled reduced deactivate the chain brake . 14 kickback bars and low kickback chains ,
Page: 16

Warning ! Warning ! Reducekdickbacbkarsandlowkickbacckhainsdonotk NoQuickstooprotherchainbrakedevicepreventksick - prevenktickbackb , uttheyaredesignetdoreducteheris backT . hesedeviceasredesignetdo reducetheriskof ofkickbacinkjuryT . heyareavailabflreomyourSTIHdLea - kickbaciknjuryif , activatedin , certainkickbacskituations . ler . InordefrortheQuickstotopreducteheriskofkickbacink - jury , it mustbeproperlmy aintaineadndingoodworking Warning ! ordeSr . eethechapteerntitle " dChainBrakea " nd " Mainte - EvenifyoursawisequippewdithaQuickstoap , reduced nanceR , epaairndStoringo " fyourOwnerM'sanuaIln . ad - kickbacbkarand / olrowkickbacckhaint , hisdoesnoteli - ditiont , heremustbeenougdhistancbeetweetnhebar minatteheriskofinjurybykickbacTk . herefoarelwayosb - andtheoperatotroensurtehattheQuickstohpassuffi - serveallsafetpyrecautiotnosavoidkickbacskituations . cienttimeto activataendstopthechainbeforepotential contacwt iththeoperator . To avoid kickback Warning ! Animpropermlyaintainecdhainbrakemayincreastehe The best protection from personal injury that may result timeneedetdostopthechainafteractivatioonr , maynot from kickback is to avoid kickback situations : activataetall 1 . Hold the chain saw firmly with both hands and main - Reducekdickbackbar tain a secure grip . STIHLgreenlabelerdeducekdickbacbkarsaredesigned 2 . Be aware of the location of the guide bar nose at all toreducteheriskofkickbaciknjurywhenusedwithSTIHL times . greenlabeleldowkickbacckhains . 3 . Never let the nose of the guide bar contact any object , Warnin ! g Do not cut limbs with the nose of the guide bar . Be Whenusedwithotherm , oreaggressicvheainsth , esebars especially careful when cutting small , tough limbs , maybelesseffectivienreducinkgickbacak , ndmayresult small size brush and saplings which may easily catch inhighekrickbacfkorces . the chain . 4 . Don't overreach . Lowkickbackchain 5 . Don't cut above shoulder height . Sometypesofsawchainhavespecialdlyesignecdompo - nentstoreducteheforceofnosecontacktickbacSk , TIHL 6 . Begin cutting and continue at full throttle . 7 . Cut only one log at a time . hasdevelopelodwkickbacckhainforyourpowerhead . 8 . Use extreme caution when re - entering a previous cut . 9 . Do not attempt to plunge cut ( see page 20 ) if you are Warning ! not experienced with these cutting techniques . Adullorimproperslyharpenecdhainmayreduceorne - 10 . Be alert for shifting of the log or other forces that may gatetheeffectosfthedesignfeatureisntendetdoreduce cause the cut to close and pinch the chain . kickbaceknergyIm . propelorwerinogrsharpeninogfthee 11 , Maintain saw chain properly . Cut with a correctly shar - depthgaugeosrshapinogfthecuttersmayincreasteh pened , properly tensioned chain at all times . chancaendthepotentiaelnergoyfakickbacAk . lwaycsut 15 12 . Stand to the side of the cutting path of the chain saw . withaproperlsyharpenechdain .
Page: 17

17 16 Pushback : Pull - in : Pull - in occurs when the chain on the bottom of the bar is Pushback occurs when the chain on the top of the bar is suddenly stopped , The chain on the bottom of the bar suddenly stopped when it is pinched , caught or encoun - ters a foreign object in the wood , The reaction of the chain stops when it is pinched , caught or encounters a foreign drives the saw straight back toward the operator and may object in the wood ( see ill , 17 ) , The reaction of the chain pulls the saw forward and may cause the operator to lose cause loss of saw control , Pushback frequently occurs control . when the top of the bar is used for cutting ( see ill . 16 ) . Pull - in frequently occurs when the bumper spike of the saw is not held securely against the tree or Iimb and when the chain is not rotating at full speed before it contacts the wood . To avoid pushback Use extreme caution when cutting small size brush and 1 . Be alert to forces or situations that may cause material saplings which may easily catch the chain and pull you off balance , to pinch the top of the chain . To avoid pull * in 2 . Do not cut more than one log at a time , 1 , Always start a cut with the chain rotating at full speed and the bumper spike in contact with the wood . 3 . Do not twist the saw when withdrawing the bar from a 2 . Pull _ in may also be prevented by using wedges to open plunge cut or underbuck cut ( figures 26 to 30 and 34 , 16 the kerf or cut . pages 19 , 20 and 22 ) , because the chain can pinch .
Page: 18

CuttingTechniques Felling Felling is cutting down a tree . Before felling a tree , consider carefully all conditions which may affect the direction of fall , including : The intended direction of the fall . The natural lean of the tree . Any unusually heavy limb structure . Escape path Surrounding trees and obstracles . Direction of fall The wind direction and speed . Warning Always observe the general conditions of the tree . Look for decay and rot in the trunk . If it is rotted inside , it could 19 snap and fall toward the operator whiie being cut . Also look for broken or dead branches which could vibrate Felling Instructions : loose and fail on the operator . When felling on a slope , the operator should stand on the uphill side if possible . First clear the tree base and work area from interfering limbs and brush and clean its lower portion with an axe , When fetling in the vicinity of roads , railways and power li - nes , etc , , take extra precautions , inform the police , utility company or railway authority before beginning to cut . Then , establish a path of escape and remove all obstacle & This path should be generally opposite to the planned di - When felling , maintain a distance of at least 21 / _ tree rection of the fall of the tree and about at a 45 ' _ angle ( ill . lengths from the nearest person ( see ill . 18 ) _ 19 ) . An alternate path must also be selected . Place all Note : tools and equipment a safe distance away from the tree , 17 but not on the escape path . The noise of your engine may drown any warning call .
Page: 19

With the conventional cut begin with the top cut of the fel - ling notch , and cut down at approximately a 45 - degree angle to a depth of about 1 / 5to _ / _ of the trunk diameter . Make the second or lower cut horizontal until it meets the first cut . Remove the resulting 45 - degree piece ( ill . 22 ) , With the open - face technique , the object is to make a 90 - degree notch in the tree trunk to a depth of approxima - tely Vsto ! / 4of the tree's diameter . Beginning with the top cut of the notch , cut down at approximately a 50 - degree angle to a depth of approximately Vsto I / 4of the diameter of the tree . Make a second cut from betow also at approxi - If the tree has large buttress roots , cut into the largest but - mately a 40 - degree angle . Remove the resulting 90odeg - tress vertically first ( horizontally next ) and remove the re - ree opemface piece ( iJl , 23 ) , suiting piece ( ill . 20 ) . With both techniques , the felling notch should be made Two felling techniques are recommended , the conventio n very carefully . When making the second cuts , look through nal cut and the open - face cuL With either technique the the previously made kerf to insure that to two cuts meet first step is to determine the placement of the felling notch properly . on the side of the tree in the planned direction of the fall ( ill . 21 ) . When properly placed the felling notch determines Once the felling notch has been completed , you are ready the direction in which the tree will fall . it is made perpendi - to begin the felling cut on the opposite side of the tree . 18 cular to the line of fall and should be close to the ground . With the conventional notch , begin the felling cut 1 to 2
Page: 20

90 ° , : 26 23 inches higher than the center of the felling notch ( i11 . 22 ) . With the open - face notch , begin the felling cut on the same level as the center of the felling notch ( ilL23 ) . Cut horizontally through the tree towards the felling notch En - gage the bumper spikes of the chain saw directly behind hHinge Felling notc the uncut portion of wood and cut towards the notch . ( ill . 24 ) . Leave approximately Vmof the tree diameter uncut , This is the hinge . Do not cut through the hinge because you could loose control of the direction of the fall . Drive wedges into the felling cut where necessary to control the fall . 24 Warning ! If the tip ofthe bar contacts a wedge , it may cause kick - back . Wedges should be of wood or plastic - never steel which can damage the chain , Always keep to the side of the falling tree . When the tree starts to fall , withdraw the bar , shut off the engine and walk away on the preplanned escape path . Watch out for falling 25 19 limbs .
Page: 21

Be extremely careful with partially fallen trees which are poorly supported . When the tree hangs or for some other reason does not fall completely , set the saw aside and pull the tree down with a cable winch , block and tackle or tractor , if you try to cut it down with your saw , you may be injured . Sectioning Method Felling a tree that has a diameter greater than the length of the guide bar requires use d either the sectioning or plunge - cut method . These methods are extremely danger - ous because they involve the use of the nose of the guide bar and can result in kickback , Only properly trained pro - fessionals should attempt these techniques , For the sectioning method ( ill , 25 ) make the first part of the felling cut with the guide bar fanning in toward the hinge , Then , using the bumper spike as a pivot , reposition the saw for the next cut , Avoid repositioning the saw more than necessary , When repositioning for the next cut , keep 28 tile guide bar fully engaged in the kerf to keep the felling cut straight . If the saw begins to pinch , insert a wedge to open the cut . On the last cut , do not cut the hinge , Plunge - Cut Method Timber having a diameter more than twice the length of the guide bar requires the use of the plunge - cut method before making the felling cut , First , cut a large , wide felling notch , Make a plunge cut in the center of the notch . The plunge cut is made with the guide bar nose . Begin the plunge cut by applying the lower portion of the guide bar 29 nose to the tree at an angle ( ill . 26 ) . Cut until the depth of 20 the kerf is about the same as the width of the guide bar
Page: 22

( ilL27 ) . Next , align the saw in the direction in which the re - Do not stand on a log while limbing it - you may slip or the cess is to be cut , log may roll . With the saw at full throttle , insert the guide bar in the trunk Start limbing by leaving the lower limbs to support the log ( ill . 28 ) , off the ground ( ill . 31 ) . When underbucking freely hanging limbs , a pinch may result or the limb may fall , causing loss of control , Enlarge the plunge cut as shown in illustration ( ill . 29 ) . If a pinch occurs , stop the engine and remove the saw , by lifting the limb . There is an extreme danger of kickback at this point , Extra caution must be taken to maintain control of the saw . To Warnin ! ! make the felling cut , follow the sectioning method descri - Be extremely cautious when cutting limbs or logs under bed previously ( ill . 30 ) , tension ( spring poles ) , The limbs or logs could spring back If you are inexperienced with a chain saw , plunge - cutting toward the operator and cause loss of control of the saw should not be attempted . Seek the help of a professional . and severe or fatal injury to the operator , Limbing Bucking Limbing is removing the branches from a fallen tree . Bucking is cutting a log into sections . Warn _ r _ g ! Warnir _ gs ! There is an extreme danger of kickback during the timbing 1 . When bucking , do not stand on the log , Make sure operation . Do not work with the nose of the bar . Be ex - the log will not roll downhill . If on a slope , stand on the tremely cautious and avoid contacting the log or other uphill side of the log ( see ili . 32 ) . Watch out for rolling 21 limbs with the nose of the guide bar . logs ,
Page: 23

1 , Relieving cut 34 2 . Cross cut o 35 2 . Cut only one log at a time , the saw from pinching . The first cut is made on the com - pression side to relieve the stress on the log ( see ill . 34 , 35 ) . The bucking cut is then made as shown . If the saw 3 . Shattered wood should be cut very carefully . Sharp sli - pinches , stop the engine and remove it from it from the vers of wood may be caught and flung in the directien of log . the operator of the saw . 6 . Only propedy trained professionals should work in an 4 . When cutting small fogs , use a sawhorse ( ill . 33 ) . Never area where the logs , limbs and roots are tangled . Wor - permit another person to hold the log . Never hold the king in blowdown areas is extremely hazardous . log with your leg or foot . Z Drag the _ ogs into a clear area before cutting . PuII out 22 5 . Logs under strain require special attention to prevent exposed and cleared logs first .
Page: 24

Warning _ In order for the chain brake on your STIHL chain MAINTENANCE , REPAIR AND STORING saw to properly perform its function of reducing the risk of Use only STIHL replacement parts for maintenance and kickback and other injuries , it must be properly maintai - ned . Like an automobile brake , a chain saw chain brake in - repair . Use of parts manufactured by others may cause se - curs wear each time it is engaged . rious or fatal injury . Never operate a chain saw that is damaged , improperly The amount of wear will vary depending upon usage , con - adjusted or not completely or securely assembled . Follow ditions under which the saw is used and other factors _ Ex _ the maintenance and repair instructions in the appropriate cessive wear will reduce the effectiveness of the chain section of your Owner's Manual , especially those in the brake and can render it inoperable . For the proper and ef - chapters entitled " Guide Bar , Chain and Sprocket " , " Shar _ fective operation of the chain brake the brake band and pening and Maintenance of Saw Chain " and " Chain Brake " . clutch drum must be kept free of dirt , grease and other for - eign matter which may reduce friction of the band on the drum , W _ rni _ g ! AIways stop the engine and ensure that the chain is stopped before making any adjustments , mainte - For these reasons , each STIHL chain saw should be retur - nance or repair work , changing the saw chain or cleaning the saw . Do not attempt any maintenance or repair work ned to trained personnel such as your Stihl servicing dea - ler for priodic inspection and servicing of the brake system not described in your Owner's Manual . Have such work according to the following schedule : performed at your STIHL service shop only , Check fuel filler cap for leaks at regular intervals . Use the specified spark plug and make sure it and the ignition lead Heavy usage - every three months , are always in good condition . Moderate usage - twice a year , Occasional usage - annually , W _ rr'dng ! A worn or damaged muffler is a fire hazard and The brake band should be replaced whenever wear has re - may cause loss of hearing . Check to see that the muffler is in good condition . The chain saw must not be operated if duced any portion of its original thickness by 25 % or more . Additionally , the daily maintenance schedule for the muffler is faulty or has been removed . Remember that your chain saw set forth in your STIHL Owner's Manual the risk of forest fires is greater in hot weather , Use the fire - safe muffler supplied with the unit . Never touch a hot muff - should be strictly followed , ler or burn will result . Keep the chain , bar and sprocket clean ; replace worn Keep spark plug and wire connection tight and clean , the spark plug electrode gap should be checked with a feeler sprockets or chains , gauge at least every 50 operating hours and reset if neces - Keep the chain sharp . You can spot a dull chain when sary . Fit a new spark plug if the electrodes are badly pitted . easy - to - cut wood becomes hard to cut and burn marks appear on the wood . Store chain saw in a dry place and away from children . Be _ Keep the chain at proper tension . Tighten all nuts , bolts fore storing for longer than a few days always empty the and screws except the carburetor adjustment screws after 23 fuel tank . each use .
Page: 25

] Foo , Fuelfiller cap removed DO not use BIA or TCW ( two - stroke water cooled ) mix oils ! Gasoline STtHL - oil STIHL - oil 0ther branded 50 : 1 40 : 1 two - stroke eng , 0ils ( 25 : 1 ) U , S . U . S . U . S . U . S . Lit , gal Lit . oz Lit . oz Lit . oz 1.0 - - 0.020 - - 0.025 - - 0.04 - - - - 1.0 - - 2.56 - - 3.2 - - 5.12 5 _ 0 - - - 0.100 - - 0.125 - - 0.20 - - - - 2.5 - - 6.4 - - 8.0 - - 12.8 10 - - 0.200 - - 0.250 - - 0.40 - - - - 5.0 - - 12.8 - - 16.0 - - 25.6 Your two - stroke engine runs on a mixture of gasoline and two - stroke , air - cooled engine oil . Use regular branded gasoline , leaded or unleaded , with a Take care when handling gasoline . Avoid direct contact minimum octane number of 90 ROZ ( U . S . A . iCanada : with the skin and avoid inhaling fuel vapour . pump octane min , 87 ! ) . If the octane number of the regular grade gasoline in your area is lower , it may cause preigni - When mixing , pour oil into the canister first , and then add tion ( " pinging " ) which is accompanied by a rise in engine gasoline . The canister should be kept tightly closed in or - temperature . This increases the risk of piston seizure and der to avoid any moisture getting into the mixture . The fuel damage to the engine . mixture must not be stored for long periods of time . Do not store large quantities . Always mix sufficient fuel for about a The chemical composition of the fuel is also important . few month's work or the project in hand . Some fuel constituents not only detrimentally affect elas - tomers ( carburetor diaphragms , oil seals , fuel lines etc , ) , Always thoroughly shake the mixture in the canister before but magnesium castings as well . This could cause running fueling your machine . The fuel tank may be under pres - problems or even damage the fuel tank . For this reason it sure . Remove cap slowly ! is essential that you use only name branded fuels ! The fuel tank and the canister in which fuel mix is stored Use only STIHL two - stroke engine oil or equivalent brand - should be cleaned from time to time . Before storing your ed two - stroke air - cooled engine oils for mixing . We recom - machine for a long period , drain and clean the fuel tank mend STIHL 50 : 1 / 40 : 1 two - stroke engine oil since it is and run engine until carburetor is dry . specially formulated for use in STtHL engines . The mix ratio with STtHL oil is 50 : 1 / 40 : ! ( 50 / 40 parts gasoline to Change the filter element in the fuel pick up body every 1 part oil ) , or 25 : 1 ( 25 parts gasoline to 1 part oil ) with 24 year . other branded two - stroke air _ cooled engine oils .
Page: 26

Chain Oil F 6 1 = Oilway in crankcase Oil filler cap removed L 2 = Oil inlet hole in guide bar The service life of the saw chain and guide bar is greatly The saw chain and guide bar must be continuously lubri - dependent on the quality of the lubricant . Only use the cated during operation to protect them from abnormal chain oil approved and recommended by STIHL wear . This is assured by the automatic chain oiling system . The speed - controlled oil pump always draws the amount Warning _ . of oil required out of the tank and feeds it to the guide bar Medical studies have shown that renewed contact with groove . The oil pump feed rate is designed to provide ade - waste oil can cause skin cancer . Avoid direct contact with quate lubrication of the bar and chain under normal opera - waste oil . If waste el ! does get on your skin , wash with ting conditions using a standard length Ecomatic guide soap and water . Do not use waste oil for any purpose , and bar . If you would like to increase the oil feed rate , contact dispose it only at authorized disposal locations . your STIHL Dealer for assistance . If special chain lubricant is not available you may - in an emergency - use one of the high - duty , single grade engine The capacities of the oil and fuel tanks are balanced in oils listed below . Choose the oil according to the prevailing such a way that a certain amount of oil , depending on outside temperature . pump feed rate , is always left in the oil tank when the fuel tank is empb : This avoids the risk of the saw being used Outside temperature Grade unintentionally without chain lubrication . SAE 30 + 10 ° C to + 40 " C ( 50 ° F to 104 _ F ) SAE 20 + 10 _ ' Cto - 10 ° C ( 50 ° F to 14 ° F ) Always fill the oil tank with chain oil when you refuel , SAE 20 W or - 10 " C to - 30 cC ( 14 ° F to 22 T ) Important : If you find the oi ! tank is still full although the SAE 10W fue ! tank is completely empty , the reason may be a fault in the chain oil supply system , In such a case , check chain Before refilling , carefully clean the filler cap and the area lubrication and , if necessary , clean the oilways or contact around it to ensure that no dirt falls into the tank , 25 your STIHL Dealer for assistance .
Page: 27

Mounting the Bar and Chain Top : Removing chain sprocket cover Center : Backing off tensioner slide on lateral chain tensioner Chain brake released Bottom : Backing off tensioning nut on front chain tensioner There are two types of chain tensioner . Depending on the model you have , tensioning is performed either through the side of the sprocket cover or from the front of the machine . Release the chain brake by pulling the front hand guard ( 1 ) back toward the handlebar . Unscrew the hexagon nuts ( 2 ) and take off the chain sprocket cover ( 3 ) . Use the screwdriver end of the combination wrench to turn the adjusting screw ( 4 ) ( lateral chain tensioner ) or the tensioning screw ( 5 ) ( front chain tensioner ) coun - terclockwise as far as the stop , This backs off the ten - sioner slide or tensioning nut ( 6 ) . 5 The cutting edges of the chain are very sharp . You should always wear gloves to protect your hands from injury when fitting the chain , mounting the guide bar , 26 tensioning the chain and checking chain tension .
Page: 28

Top : Fittinsgawchainonguidebar CenterF : ittintghechainonthesprock - ect uttingedges pointtowarbdarnose BottomP : egoftensionselride / tensionninugtinlocating hole - guidebarflatagainsstawbody Pretensionthinegchainlateraclhaintensioner ) Hold the guide bar vertically with the nose upward and fit the Oilomatic chain on it , starting at the bar nose . With the chain in position , locate the slot of the guide bar over the studs ( 7 ) and place the Oilomatic chain over the sprocket ( 8 ) at the same time . Be sure that the cutting edges on the top of the bar point toward the bar nose . The peg of the tensioner slide / tensioning nut ( 6 ) must engage the lower guide bar locating hole . Now tension the chain by turning the adjusting screw ( 4 ) or tensioning screw ( 5 ) clockwise until there is very little chain sag on the underside of the bar . Make sure that the drive link tangs ( 9 ) are properly located in the guide bar groove . Fit the sprocket cover ( 3 ) on the studs ( 7 ) and screw on the hexagon nuts ( 2 ) finger - tighL 27
Page: 29

Tensioning the Saw Chain Top : Tensioning the chain ( lateral chain tensioner ) Bottom : Holding bar nose up and tightening the hexagon nuts Checking chain tension The Oilomatic chain is correctly tensioned when it fits snugly against the underside of the bar but can still be pulled easily along the bar by hand ( with chain brake disengaged ) . Important : Wear protective gloves when performing this work . Proper chain tension and lubrication are critically impor - tant for the cutting performance and service life of your whole cutting attachment . Always check chain lubrica - tion before starting work . The chain must be tensioned after initial assembly and Chain tension should be checked frequently during cut - retensioned during cutting work . ting work and corrected as necessary . For further details To retension the chain , first slacken off the hexagon nuts see Chapter " Bar , Chain and Sprocket " . ( 2 ) . Insert screwdriver end of combination wrench through hole in chain sprocket cover . Hold the bar nose ( 10 ) up and turn the adjusting screw ( lateral chain tensioner ) or tensioning screw ( front chain tensioner ) clockwise with the screwdriver until the chain lies against the underside of the bar . While still holding the bar nose up , firmly tighten down the hexagon 28 nuts ( 2 ) .
Page: 30

Chain Brake Top : Chain brake engaged Bottom : Chain brake released The chain brake can be activated either manually or by inertia . - Manual engagement is effected by pushing the front hand guard forwards with the left hand . - The mass moment of inertia of the front hand guard also engages the chain brake in certain situations . Ifthe kickback force of the saw is high enough , the mass moment of inertia of the hand guard provides the activat - ing impulse for the chain brake . The hand guard is an integral part of the chain braking system . It must not be modified in any way otherwise il will be deactivated . The great advantage of the inertia chain brake is that the brake is activated after severe kickback even if the ope - rator's left hand is not behind the front hand guard , e . g . as is the case when performing the felling cut . Engaging the chain brake When the hand guard is moved towards the nose of the guide bar ( either manually or by inertia ) , the brake lever Maintenance is unlatched and the brake band is clamped round the clutch drum at the same instant . This causes the saw The chain brake is subject to normal wear . Dust , oil or chain to be brought to a standstill and locked in position . foreign debris in the chain brake mechanism may lead to increase chain stopping times . It is therefore necessary to have it regularly serviced and maintained ! For specific important : Apart from starting and emergencies , the chain brake maintenance instructions , see section chain brake may be engaged only when the saw is idling . " Maintenance , Repair and Storing " of the owner's manual . Releasing the chain brake The locked saw chain must be released before cutting Always carry out an operational check by activating the can be continued . To do this , pull the hand guard back chain brake at least once before starting work , Make toward the handlebar - this disengages the brake band sure the hand guard is free from dirt to ensure that its 29 from the clutch drum . smooth operation is not impaired in any way .
Page: 31

Genera | Notes on Operation Top : Spark plug in good condition Bottom : Spark plug fouled because of incorrect running conditions Starting for first time A factory new machine should be run with the carburetor set slightly on the rich side for the first three tank fillings ( see chapter on " Carburetor " ) so that the cylinder bore and the bearings receive additional lubrication during the break - in period . As all the moving parts have to bed in during the break - in period , the frictional resistances in the engine are greater during this period . For this reason the engine only develops its maximum power after about 5 to 15tank fillings . The carburetor setting must never be made leaner in order to achieve an apparent increase in power as this could cause the engine to exceed its maximum permissible rpm ( see " Specifications " and " Carbure - tor " ) . During operation After a long period of working at full toad it is advisable not to shut off the engine immediately , but let it run for a short while at idling speed . This allows the heat which has been generated in the engine during full throttle ope - ration to be dissipated by the flow of cooling air and also If the engine is down on power , difficult to start or runs protects engine - mounted components ( ignition , carbu - poorly at idling speed , check the spark plug before retor ) from thermal overload , looking any further . If the spark plug is dirty , clean it and check the electrode gap . Readjust if necessary ; the correct gap is 0.5 mm ( 0.02 in ) . The spark plug should be Spark plug replaced after about t00 operating hours or earlier if the An incorrect carburetor setting , the wrong fuel mix ( too electrodes are badly eroded . much engine oil in the gasoline ) , a dirty air filter and un - favorable running conditions ( mostly at part throttle etc . ) tn order to ensure trouble - free operation it is necessary affect the condition of the spark plug . These factors to rectify the faults which have caused fouling of the cause deposits to form on the insulator nose which may 3O result in trouble in operation . spark plug .
Page: 32

Top : Master Control tever locked by throttle lever Master Control ( start position ) Center : Master Control lever in operating position Bottom : Ground contact touching contact spring ( stop position ) The Master Control lever ( 1 ) controls the various engine functions . Depending on its position , it acts on the carbu - retor's choke valve , the throttle trigger ( 2 ) or the ground contact ( for stopping the engine ) . Note the following when operating the Master Control lever : The position between " START " and " STOP " is the normal operating position . The safety throttle lock ( 3 ) must be pressed down before the Master Control lever ( 1 ) is moved from the normal operating position to " START " . tt is possible to move from " START " to " CHOKE " or vice versa without touching any other controls , In the " START " position the choke valve is open and the throttle trigger is in the starting - throttle position , When in this position , the Master Control lever ( 1 ) is locked by the throttle lever and must not be forced into the normal op _ erating position . It returns automatically to the normal operating position as soon as the throttle trigger ( 2 ) is squeezed . tn the " CHOKE " position ( cold start ) the choke valve is closed and the throttle trigger is in the starting _ throttle position , In the " STOP " position the ground contact engages the 31 contact spring - this cuts out the ignition system ,
Page: 33

Top : Master Control tever locked by throttle lever Master Control ( start position ) Center : Master Control lever in operating position Bottom : Ground contact touching contact spring ( stop position ) The Master Control lever ( 1 ) controls the various engine functions . Depending on its position , it acts on the carbu - retor's choke valve , the throttle trigger ( 2 ) or the ground contact ( for stopping the engine ) . Note the following when operating the Master Control lever : The position between " START " and " STOP " is the normal operating position . The safety throttle lock ( 3 ) must be pressed down before the Master Control lever ( 1 ) is moved from the normal operating position to " START " . tt is possible to move from " START " to " CHOKE " or vice versa without touching any other controls , In the " START " position the choke valve is open and the throttle trigger is in the starting - throttle position , When in this position , the Master Control lever ( 1 ) is locked by the throttle lever and must not be forced into the normal op _ erating position . It returns automatically to the normal operating position as soon as the throttle trigger ( 2 ) is squeezed . tn the " CHOKE " position ( cold start ) the choke valve is closed and the throttle trigger is in the starting _ throttle position , In the " STOP " position the ground contact engages the 31 contact spring - this cuts out the ignition system ,
Page: 34

Sta _ ing Top : Master Control lever on " CHOKE " ( cold start ) Center : Master Control lever on " START ' ( warm start ) Chain brake engaged Bottom : Starting above the ground Regardless of the starting method choosen maintain secure footing and be sure that the guide bar and chain are clear of you and alt other obstructions and objects , including the ground . Bystanders must be kept well clear of the general work area of the saw . Starting procedure 1 . Engage the chain brake by pushing the hand guard ( 1 ) towards the bar nose . 2 . If the engine is cold , set Master Control lever ( 2 ) to " CHOKE " . If the engine has been warmed up , set Master Control lever ( 2 ) to " START " . This also applies if the engine has been running but is still cold . The throttle trigger interlock ( 4 ) must always be engaged before moving the Master Control lever ( 2 ) to the " START " or " CHOKE " position . This automatically sets the throttle trigger ( 3 ) in the starting - throttle position . 3 , Starting the saw 3.1 Starting above the ground Grip the front handle ( 5 ) of the saw with your left hand . Hold the rear handle of the saw tightly 32 between your legs , just above the knees .
Page: 35

Top : Starting on the ground Center : Master Control lever in normal operating position - throttle trigger in idle position Bottom : Master Control lever on " STOP " Keep the arm on the front handle in a locked ( straight ) position . 3.2 Starting on ground level Hold the saw firmly on the ground with your left hand on the front handle ( 5 ) , and put your right foot into the rear handle ( 6 ) and press down . 4 . Pull the starter grip ( 7 ) slowly with your right hand until you feel the starter engage , then give the grip a brisk strong pull . The starter rope must not be pulled out more than 70 cm ( about 28 in ) as it might otherwise break . Do not let the starter gdp ( 7 ) snap back . Guide it slowly into the housing so that the starter rope can rewind properly , 5 . Crank the engine until it begins to fire . tf starting from cold , immediately open the choke ( Master Control to " START " ) and continue cranking . As soon as the engine is running , immediately squeeze the throttle trigger ( 3 ) to disengage it from the starting throttle position . The Master Controt lever moves from the start position to its normal operating position and the engine runs at idle speed , Damage may be caused to the clutch if the engine is not immediately returned to idle speed . 6 . Disengage the chain brake before starting work by pulting the hand guard ( 1 ) back toward the handle - bar ( 5 ) . 7 . The engine is stopped by moving the Master Control 33 lever ( 2 ) to " STOP " .
Page: 36

Electric Handle Heating ( Option ) Heating switched on Caution : If the Master Control lever is in the " START " position , it must first be disengaged from this position by squeezing the throttle trigger . Only then can the Master Control lever be moved to the " STOP " position . Other points to observe when starting : The choke valve is operated by the Master Control lever ( see " M aster Control " ) . When starting a cold engine only keep the Master Con - trol lever in the " CHOKE " position until the engine fires . The handle heating system keeps the handle bar and Then move Master Controt lever immediately to " START " , pistol grip comfortably warm while the chain saw is being operated at extremely low outside temperatures . even if the engine stops and you have continue cranking . If you leave the Master Control lever on " CHOKE " , the Control is by means of a switch mounted on the tank combustion chamber will flood and stall the engine . housing . Integrally cast symbols on both sides of the switch indicate the operating condition : " 0 " for heating If you have moved the Master Control lever to " START " off - " 1 " for heating on . The switch must , therefore , be and the engine still does not run after several attempts , it moved to " 1 " to start the heating process . is already flooded . In such a case , remove and dry offthe spark plug . With the spark plug still removed , set the Master Control lever to " STOP " and crank the engine The heating system is designed to provide an adequate over several times with the starter to clear the com - level of heat in the handle bar and pistol grip . There is no bustion chamber . When you now try to start , move the risk of overheating during continuous operation . The en - tire system is maintenance - free . Master Control lever to " START " - even if the engine is cold . At very low outside temperatures you should still move the Master Control lever to " START " and disengage the throttle trigger from the starting throttle position by briefly accelerating the engine - but then warm up the engine at part throttle for a short period . A new engine or one which has been run until the fuel tank is dry will not start first time after fueling because fuel will only begin to reach the carburetor after the 34 engine has been cranked over several times .
Page: 37

intake Air Preheating ( Optional Extra ) Top : Carburetor box cover with seal Plug fitted in shroud Bottom : Cover plate in fan housing The intake air preheating kit prevents the air filter and carburetor becoming iced in very cold weather and also stops snow entering the fan housing . Carry out the conversion to intake air preheating as fol _ lows : Remove the standard carburetor box cover and take the plug ( 1 ) out of the shroud . Fit the carburetor box cover with seal ( 2 ) . The engine now draws in air heated by the cylinder . Caution : The following parts of the intake air preheating kit may be installed only under the conditions specified below This is necessary in order to exclude the risk of the engine overheating . The cover plate ( 3 ) should be placed in the fan housing to stop snow being drawn into the machine through the intake slots , Carburetor box cover with seal below + 10 ° C ( + 50 ° F ) Cover plate in fan housing below - 10 ° C ( + 4 ° F ) The standard guard in the chain sprocket cover can be replaced by the smooth contour guard supplied with the Every intake air preheating kit comes complete with kit , It ensures optimum chip discharge even in wet condi - 35 tions . detailed assembly instructions .
Page: 38

Guide Bar , Chain and Sprocket Checking chain lubrication Guide bar The nose and underside of the guide bar are subject to a particularly high rate of wear . To avoid one - sided wear , turn the bar over every time you resharpen or replace the chain . Regular cleaning of the oil inlet holes and guide bar groove is also important . The bar can be examined for signs of wear at the same time . A minimum bar groove depth must be maintained in or - der to prevent the drive links contacting the bottom of the groove ( the heels of the cutter and tie strap would no lon - Breaking in Oilomatic chain ger ride on the guide bar rails ) . The groove depth varies according to chain type and pitch : Every new chain has to be broken in for about 2 to 3 mi - nutes . Ample chain lubrication is essential during this period . After breaking in , check chain tension and adjust Chain type Chain pitch Minimum depth if necessary . Rapid 0,325 " 6.0 mm ( 0.24 " ) Topic 0.325 " 6 _ 5 mm ( 0.26 " ) Chain lubrication Never operate the chain saw without proper chain lubri - cation . Ifthe chain is allowed to run dry the whole cutting The groove depth should be measured at the point where the bar is stressed most . That is the bar nose on attachment will be irretrievably damaged within a very short time . FortHs reason you should always check ope _ Duromatic bars and the area where most of the cutting is done on Rollomatic bars . The guide bar must be ration of the chain lubricating system and the level in the replaced when groove depth is less than the specified oil tank before starting work . minimum . Start the saw and hold the cutting attachment over a light patch of ground . Take care - the Oilomatic chain must On Rollomatic guide bars it is net necessary to separa - tely lubricate the sprocket nose bearing because the not touch the ground ; hold it at least 20 cm ( 8 in ) clear of the ground . Run the engine at about half throttle . If an chain oil which flows to the bearing by way of the bar groove during normal operation is adequate for lubrica - increasing film of oil can be seen on the ground , chain 36 tion , lubrication is operating correctly .
Page: 39

Worn chain sprocket Chain tension Apart from chain lubrication , chain tension is the factor that has the greatest influence of the cutting attach ° ment's useful life . It is therefore necessary to check chain tension before starting work and at regular short intervalsduring cutting work , Chain tension is correct in the cold condition when the chain fits snugly against the underside of the bar and can still be pulled along the bar by hand ( wear glovesl ) , As it warms up to normal operating temperature the chain expands and sags noticeably , The saw chain must be retensioned when the drive links begin to come out of the groove on the underside of the bar , Ifthis is not done , there is a risk of the chain jumping off the bar , Ifthe chain is retenstoned during cutting work it must al - ways be slackened off again after finishing work , This is necessary because high contraction stresses wouldnt otherwise occur as the chain cools down to ambie temperature , especially at extremely low outside tempe - ratures , and cause damage to the crankshaft and bea - rings , A new chain must be retensioned more frequently than a used one because it stretches during the initial break - in period . Chain sprocket The stress and strain on the chain sprocket are particu - larly high , If the wear marks on the teeth are very pro _ nounced ( about 0 _ 5 ram / 0,02 in deep ) , the sprocket should be replaced . A worn sprocket reduces the ser - vice life of the saw chain . The chain sprocket should be replaced as a matter of routine with every second Oiloo matic chain . It is best to use two saw chains alternately 37 with one sprocket ,
Page: 40

Air Filter Top : Loosening the carburetor box cover ( 028 WB ) Center : Loosening the air filter ( 028 AV ) Bottom : Prying apart the air filter halves The air filter's function is to hold back dust and dirt in the intake air and thus reduce wear on engine components to a minimum . Dirty air filters reduce engine power , increase fuel con - sumption and make starting more difficult . Clean the air filter daily or even more often if the air is exceptionally dusty in the work area . For removing the carburetor box cover on 028 AV turn the twist lock and on 028 WB the slotted nut ( 1 ) in coum terclockwise direction . Before taking out the air filter , re - move all the wood chips , etc . from around the filter . After - wards remove on 028 AVthe slotted nuts ( 2 and 3 ) and on 028 WB the slotted nut ( 3 ) with a screwdriver . The air filter may now be completely pulled off the stud bolts . Pry the filter halves apart with a screwdriver . For daily cleaning it is sufficient to clean both parts of the filter and the prefilter in the carburetor box cover with a natural bristle paint brush , tn addition to this you should wash the complete air fitterin a fresh , non - flamm - able cleaning solution ( lukewarm soapy water , engine cleaner etc . ) at least once a week and blow it out with compressed air if possible . Important : Flocked filter elements must not be cleaned with compressed air , brushes or rags . It the wire mesh is damaged on either half of the air filter ( or if the flocking is damaged ) , always fit a new part . It is best to carry a spare filter element with you at all times . Before you refit the air filter , check that the choke shutter 38 is in good condition .
Page: 41

Carburetor 1 = High speed adjusting screwww 2 = Low speed adjusting rscree 3 = idle speed adjusting sc Regulating idle speed adjusting screw 1 2 When the engine is tested at the factory the carburetor is engine speed will be exceeded . This can cause engine set to obtain a slightly richer mixture to ensure that the damage , brought about by lack of lubrication and over = cylinder bore and the bearings receive additional lubri - heating in padicular _ Corrections to the setting of the cation during the breakqn period . This setting should be high speed adjusting screw may be carried out only if an accurate tachometer is available to check the maximum left as it is for the first three tank fillings , The high speed adjusting screw may then be turned no more than _ / : 4turn engine speed of 13,000 r , p , m _ ( 12,500 = 028 WB ) ( with bar and correctly tensioned chain ) . clockwise ( leaner mixture ) . Caution : The engine's maxi = mum permissible rpm must not be exceeded ! Basic setting If you use your chain saw at high altitudes ( mountains ) or at sea level it may be necessary to change the carburetor If it is necessary to readjust the carburetor again from the beginning , first carry out the basic setting to obtain a setting slightly . Carry out the correction at the two adjusting screws ( L and H ) as follows : Turn clockwise starting point for fine adjustment . To do this , carefully ( leaner ) for high altitude operation or counterclockwise screw the two adjusting screws down onto their seats ( richer ) for operation at sea level . ( clockwise ) , Then make the following adjustment : Note that even slight alterations on the adjusting High speed adjusting screw H : screws have a noticeable effect on the engine's running back off 1V4complete turn behavior . Only carry out carburetor adjustments after cleaning the air filter and warming up the engine . Low speed adjusting screw L : back off 1V4complete turn Caution : Adjustment of the high speed adjusting screw not only affects the power output but also the maximum If you have no means of checking the maximum engine off - load engine speed , if the setting is too lean ( screw speed , do not set the high speed adjusting screw any 39 turned too far clockwise ) , the maximum permissible leaner by turning it beyond the basic setting .
Page: 42

Notes for adjusting idle speed Engine stops while idling Turn idle speed adjusting screw ( LA ) clockwise until chain begins to run . Then back off one quarter of a turn , Chain runs when engine is idling Turn idle speed adjusting screw ( LA ) counterclockwise until chain stops running and then turn it about another quarter turn in the same direction . Erratic idling behavior ; poor acceleration Idle setting too lean ; turn low speed adjusting screw ( L ) counterclockwise until engine runs and accelerates smoothly . Exhaust smokes at idle speed Idle speed setting too rich ; turn low speed adjusting screw ( L ) clockwise until engine speed drops . Then turn screw back one quarter turn and check that engine still accelerates smoothly when you open the throttle . A correction at the low speed adjusting screw usually necessitates a change in the setting of the idle speed adjusting screw ( LA ) . Apart from minor readjustments , you should leave all carburetor setting and repair work to your STIHL dealer . STIHL dealers have trained staff and all the necessary 40 servicing tools and equipment .
Page: 43

Replacing the Chain Sprocket Top : Unscrewing the cover Center : Removing E - cLip Bottom : Removing circlip Removing the side plate Spur sprocket First disengage the chain brake by pulling the hand guard back against the handlebar . Now remove the chain sprocket cover , Oilomatic chain and guide bar . Release and unscrew the six pan head screws which hold the side plate ( 1 ) and cover ( 2 ) . Insert a pointed knife or similar tool behind the E - clip ( 3 ) to ease it clear of the warts on the thrust washer ( 4 ) and then use a small screwdriver to prise the E - clip off the crankshaft . Pull off the thrust washer and use circlip pliers 5910 893 1805 ( special accessory available from your STIHL dealer ) to take the circlip ( 5 ) off the chain sprocket , The washer ( 6 ) can now be removed from the chain sprocket . Removal of this washer ( 6 ) is made easier if you hold the chain sprocket ( 7 ) steady and prise the cover ( 2 ) slightly away from the crankcase . Then take off the cover as well . 41
Page: 44

Top : Removing drive worm Center : Circlip correctly fitted Bottom : Rim sprocket in position Remove the oil pump drive worm ( 8 ) from the pump shaft by turning it clockwise and pulling it at the same time . The chain sprocket ( 7 ) can now be pulled off the crank - shaft together with the spur gear ( 9 ) and needle cage . The spur gear ( 9 ) can be prised off the chain sprocket ( 7 ) with the aid of two screwdrivers . Clean the stub of the crankshaft , wash the needle cage , spur gear ( 9 ) and worm ( 8 ) in clean gasoline . Lubricate the needle cage with STIHL multipurpose grease . Reverse the above sequence for reassembly . Examine spur gear ( 9 ) and worm ( 8 ) for worn or broken teeth and replace if necessary . Coat the teeth of the spur gear and worm with STIHL multipurpose grease when installing . The circlip ( 5 ) must be fitted so that both its ends locate on the top of a tooth as illustrated . Rim sprocket _ r _ lHH First remove the chain sprocket cover , Oilomatic chain and guide bar . Insert a pointed knife or similar tool behind the E - clip ( 3 ) to ease it clear of the warts on the th rust washer ( 10 ) and then use a small screwdriver to prise the E - clip off the crankshaft . Take off the thrust washer and rim sprocket ( 11 ) . Fit the new rim sprocket so that the side with the cavities faces outward . Finish off by refitting the thrust washer ( 10 ) and E - clip 42 ( 3 ) on the crankshaft .
Page: 45

Starter Assembly Top : Special knots Bottom : Component parts of starter assembly Remove the mounting screws Replacing a broken starter rope First remove the four screws which retain the fan hous - ing . Then lift the base of the fan housing clear of the crankcase so that you can pull it downwards and remove it from the machine . Use a screwdriver or a suitable pair of pliers to carefully remove the spring clip ( 1 ) from the starter post . Now take off the rope rotor ( 2 ) together with the washer ( 3 ) and pawl ( 4 ) . Remove any remaining rope from the rope rotor . Thread 8 new 3,5 mm ( OA4 in ) diameter and 960 mm ( 37 _ 8 in ) long starter rope ( 5 ) into the rope rotor and secure it with a simple overhand knot , Seal the ends of the rope with a match or lighter flame to prevent ravelling . Thread the other end of the rope through the rope guide in the fan housing from inside , pass it upwards through the under - side of the starter grip and secure it with a figure 8 or looped overhand knot ( see illustration of knots ) . Do not wind the rope onto the rotor at this stage . Clean and lubricate the rope rotor's bushing with a non - resinous oil . Slide the rotor onto the starter post and turn it back and forth until the slotted area engages the 43 anchor loop of the rewind spring ( 7 ) .
Page: 46

Installing the spring clip Tensioning the rewind spring Tensioning the rewind spring Now insert the pawl ( 4 ) in the rope rotor ( 2 ) and fit the washer ( 3 ) on the starter posL Use a screwdriver or a With the starter rope ( 5 ) fully extended , make a loop in suitable pair of pliers to press the spring clip ( f ) onto the the rope between the rotor ( 2 ) and fan housing and use it starter post , making sure that the spring clip engages on to turn the rope rotor ( 2 ) six full revolutions clockwise , the pawl's guide pin and points in the clockwise direc - Hold the rope rotor steady in this position . Pull out and tion . Finish off by tensioning the rewind spring ( see straighten the twisted rope ( 5 ) . Now release the rope below ) . rotor gradually and allow spring force to wind the starter rope fully onto the rope rotor . Replacing a broken rewind spring The rewind spring is correctly tensioned ifthe starter grip First remove the rope rotor ( 2 ) . Take the spring housing is held firmly in place against the starter housing and and rewind spring ( 7 ) out of the fan housing ( 8 ) . does not droop to one side . If this is not the case and more tension is required , add one more turn on the rope The replacement spring and spring housing are supplied rotor . When the starter rope is fully extended it must be as an assembly . Lubricate the spring with a few drops of possible to rotate the rope rotor at least another half turn non - resinous oil before installing it . before maximum spring tension is reached , tf this is not the case , hold the rope rotor firmly and take off one turn Drop the rewind spring ( 7 ) and housing assembly ( bet - of the rope . tom plate area must face up ) into the fan housing ( 8 ) , making sure the outer spring loop engages over the cast The rewind spring will break prematurely if it is over - lug on the fan housing . If the spring should pop out of its tensioned . housing during installation , refit it in the counterclock _ wise direction , starting outside and working inwards . 44 Finish off by refitting the fan housing . Reassemble the rope rotor ( 2 ) as above .
Page: 47

Maintenance Chart Visual inspection ( condition , leaks ) x × Complete machine Clean X Throttle trigger , safety throttle lock , Master Centrot × × Check operation Check operation x X 29 Chain brake X Clean by STtHL Dealer C _ eao wire filter X Filter in fuet tank Replace felt Fuel tank Clean Chain oi ! tank Clean Chafe lubrication Check x 36 X Inspect , also check sharpness Saw chain Check chain tension > { 37 Sharpen x 47 Inspect ( wear damage } 36 C _ ean and tam over X X Guide bar Deburr X Replace Check x Chain sprocket 37 Clear 38 Air filter Replace x 38 Coo _ ing inlets Clean X Cylinder fins Clean × Check idle adjustment - chain must not turn Carburetor 39 Readjust idle x 39 Spark piug 30 Readjus _ _ _ electrode gap All accessible screws and nuts ( not adjusting screws ) Retighten x I x x Inspect Rubber vibration buffers To be replaced only by STIHL Dealer a x Inspect . . . . . . . . . . Spark arrestor screen . . C . . lean or replace x Check x Chain catcher Replace 45
Page: 48

nu , , 11 Engine STiHL single - cylinder two - str0ke engine STIHL reduced kickback bar ( with green label ) : 028 028 S Rollomatic with sprocket nose Piston displacement : 47 cm _ 51 _ 5 em _ 40 , 45 or 50 cm ( 16 , 18 or 20 in ) ( 2,86 culn ) ( & 14 cu . ln ) STIHL low kickback chain * ( with green label ) : Cylinder bore : 44 mm 46 mm 8.25 mm ( 0325 " ) Topic - Micro ! ( 26 TM ! ) or ( 1.73 in ) ( 1.81 in ) 932 mm ( s / d ' ) Rapid . Micro 2 ( 33 RM 2 , 36 RM 2 ) Piston stroke ' , 31 rnm ( 1,22 in ) 31 mm ( 1,22 in ) Chain sprocket : Max ; engine speed with 7 _ tooth for 0.325 " pitch or 8 - tooth for 3 / 8 " pitch bar and chain : 12,500 r , p , m , 13,000 rp , m , i . i . . . . . . . . . . . . . . . . . . . Ignition System Since new bar / chain combinations may be developed after publication of this Manual , ask your STIHL dealer Principle : Breakedess , transistor or for the latest STIHL recommendations . thyristor controlled magneto Ignition timing : 2.2 - 2,9 mm ( & 087 - 0.114 in ) Other bars and chains available for this powerhead before T . D , C , at 8,000 r , p . m are : Spark plug ( suppressed ) : Bosch WSR 6 F or NGK BPMR 7 A Heat value 200 STIHL yellow - labeled bar : Rollomatic " S " with sprocket nose Electrode gap 0,5 mm ( 0.02 in ) 40 . 45 or 50 cm ( 16 , 18 or 20 in ) Spark plug thread M 14 x 125 : Duromatic with stellite tipped nose 9.5 - rim 10,37 in ) long 40 . 45 or 50 cm ( 16 , 18 or 20 in ) Fuel / Og System Carburetor : STIHL yellow - labeled chain : & l ! position diaphragm carbu - for 0.325 " oitch : retor with integral fuel pump Air filter : Topic Micro [ 26 TM ) , Topic Super ( 26 TS ) Bisectional flat wire mesh type 0,5 L { 1.06 US pt ) for 3 / _ , pitch : Fuel tank capacity : Topic Micro ( 33 TM , 36 TM ) , Topic Super ( 33 TS , 36 TS Fue ! mixture : See chapter " Fuel " Chain lubrication Fully automatic oil pump 0.3 L ( 0.63 US pt ) In order to comply with the kickback performance Oil tank capacity : requirements of § 4 _ 12 of ANSI Standard B 175.1 - 1985 do not use replacement saw chain unless it has been Weight without bar and chain : 5.7 kg ( 12,6 Ib ) designated as meeting [ he ANSI § 4.12 requirements on this specific powerhead , or has been designated as " low kickback " saw chain ' in accordance with the Cutting Attachment ANSI B 175.1 - 1985 standard Recommended cutting attachments for compliance with § 4.12 of ANSi Standard B 175.1 - 1985 46 * See definition ol " low kickback chain " on Page 12 . ( see page 12 of this Manual ) :
Page: 49

Sharpening and Maintenance of Saw Chain Top : Component parts of an Oilomatic chain Bottom : Measuring chain pitch " t ' Description of chains The illustration on the right shows the component parts of a STIHL saw chain . Every chain manufactured by STIHL features the Oilomatic system . Apart from the three basic types ( Rapid , Topic and Picco ) , there are three different versions whose names denote the cutter shape , i . e . chip - per tooth = Standard , semi - chisel = Micro and full chisel = 2 _ Super . The main size measurement on a saw chain is the pitch . It is determined by measuring the distance between one ri - vet and the next but one and dividing the measurement by two . The result is the pitch which is generally specified in inch ( 3 / _ s = " 9.32 mm ) . Like any other cutting tool , the saw chain is subject to nor - y - 5 6 7 mal wear and tear . A properly sharpened chain slices through wood and requires very little infeed effort . For this reason alone you should never attempt to cut with a dull or t Right hand safety link 5 - Drive link damaged chain . There are a few crucial angles which must 2 = Right hand cutter 6 = Left hand cutter be observed in order to obtain good results when sharpe - 3 = Preset tie strap 7 = Tie strap ning a chain . They are explained below . ( with rivets ) 8 = Left hand safety 4 = Rivet link Filing angle The filing angle for Rapid - Standard , Rapid - Micro and To - pic - Micro chains is 35 ° ; these chains are sharpened to this angle before leaving the factory . Howeveh if you want to use the chain primarily for cutting hardwood or frozen tim - ber , it is best to sharpen it to an angle of 30 " . Rapid - Super and Topic - Super chains are always sharpened to 30 " . It is essential to ensure that the filing angle is kept exactly the same on all cutters . Irregular angles will cause the chain to run roughly and unevenly as well as accelerate 47 the rate of wear and increase the risk of breakage .
Page: 50

Top : Filing angle Center : Side plate angleameters Bottom : Table of file di Side plate angle Rapid - Standard The upright cutting edge just below the top plate is known Rapid - Micro Rapid - Super as the side plate cutting edge , The side plate angle is , Topic - Micro Topic - Super therefore , the angle between the side plate cutting edge and the horizontal line formed by the cutter toe and heel . The following side plate angles are specified : Rapid - Standard 80 ° Topic - Micro 70 ° Rapid - Micro 70 _ * Topic - Super 70 ° Rapid - Super 80 ° These angles are obtained automatically if you use a file holder or roller filing guide with the specified size of file ( diameter ) and hold the file correctly during sharpening . Rapid - Standard Rapid - Micro Rapid _ Super Topic - Micro Topic - Super Top plate cutting angle The top plate cutting angle is the most important angle since it influences the chain's cutting behavior , It is also P " * o obtained automatically if sharpening is performed pro - perly with a suitable STIHL sharpening tool , Sharpening Only special saw chain files may be used for sharpening Chain pitch File dia , File No . and they must match the chain concerned ( basic type , pitch ) . The shape and cut of machinists ' files makes them . 325 " ( 8.25mm ) Rapid 3 / _ 6 " ( 4.8mm ) 0811 411 8088 unsuitable for saw chain , tt is best to use the special chain . 325 " ( 8.25 mm ) Topic % 2 " ( 4.0 ram ) 0814 242 3383 file with a file holder or other filing aid . Always file from 3 / , 8 " ( 9.32 mm ) Rapid 3 / ld ' ( 4.8 mm ) 0811 4 ! 1 8088 the inside to the outside of the cutter . If you sharpen the 3 / 8 " ( 9.32mm ) Topic 5 ; 32 " ( 4.0ram ) 08142423383 chain while it is on the bar , increase chain tension before , 404 " ( 10.26mm ) _ 16 " ( 4.8mm ) 0811 411 8088 filing and reset it to correct tension afterward . V'Z ' ( 12.7mm ) 1A " ( 6.3mm ) 0811 4 ! ! 8118 All cutters must be filed to the same length . Since the top 48 plate slopes downward to the rear ( clearance angle ) , the
Page: 51

Top : File position for Rapid - Standard , Rapid - Micro and Topic - Micro File position for Rapid - Super and Topic - Super Bottom : Sharpening with file holder Micro and Topic - Micro chain so that it is at 90 ° to the perpendicular faces of the chain links or the guide bar . On Rapid - Super and Topic - Super chains the file must be guided so that the handle is 10 ° lower than the tip of the file , i . e , in this case the file must run upward at an angle of 10 ° to the horizontal . A filing aid ( file holder , filing tool ) must always be used for sharpening Rapid - Super and Topic - Su - per chains . File evenly and steadily and note that the file only shar - pens on the forward stroke , Lift the file off the cutter on the backstroke . Make sure you do not touch the tie straps cutter heights will be uneven if the cutter lengths are diffe - and drive links with the file . Use a piece of hardwood to re - rent , If the cutters are not all the same height the chain will move burrs from the cutting edge , run roughly and eventually break . As it is very important to achieve uniform cutter lengths , it Important : Sharpen the chain frequently and take away is best to measure them with a slide caliper . Find and shar * as little material as possible . Two or three strokes of the file pen the shortest cutter first and then use it as a master for are usually sufficient to the keep the chain sharp . Varia - all the others , i , e . all cutters must be filed back to the tions in angles and the lengths of the cutters cannot be same length as the master cutter , Sharpen all the cutters completely avoided during manual sharpening . For this on one side of the chain first and then repeat the proce - reason the chain should be restored to its original condi - dure on the other side , tion with a workshop chain sharpener ( STIHL USG , STIHL FG 2 ) after it has been resharpened about five times by 49 hand . The file must be held level for Rapid - Standard , Rapid *
Page: 52

Top : Table of recommended depth gauge settings Center : Depth gauge setting Bottom : Filing down depth gauge ( _ . ) pic chain ) Depth gauges Chain pitch Setting Filing gauge The depth gauge determines the height at which the cutter enters the wood and thus the thickness of the chip remo - . 325 " ( 8.25 mm ) 0.65 mm 11108934000 ved . The cutting capacity and life of a saw chain are there - _ / d ' ( 9,32 mm ) 0.65 mm 1110 893 4000 fore influenced by the distance between the depth gauge . 404 " ( 10.26 mm ) 0.8mm 11068934000 and the cutting edge , i , e . the depth gauge setting . This VY ' ( 12,7 mm ) 0.8 rnm 1106 893 4000 setting varies according to chain pitch and must be chec - ked with the appropriate filing gauge . 090 G chain saw V2 " ( 12.7 ram ) 1.2 mm 1106 893 4010 The best cutting results are obtained with the settings li - sted in the table . However , the depth gauge setting may be increased by 0.2 mm for cutting softwood in mild weat - her conditions . Since the depth gauge setting is reduced when the cutter is sharpened , its height must be checked and { owered if necessary , tf the depth gauge projects from the filing gauge , it must be filed down level with the gauge using a flat or triangular file , The contour of the depth gauge must also be rounded off on Rapid chain . In the case of Topic chains the depth gauge should be rounded off in line with the stamped markings . General chain maintenance Chain maintenance begins as soon as the chain is fitted on the bar and sprocket . The essential points are correct chain tension and ample lubrication . See also " Guide Bar , Chain and Sprocket " . Clean the chain thoroughly in gasoline after sharpening to 50 remove filings or grinding dust . Then lubricate the chain by
Page: 53

Table of file holders immersinitginanoilbathI . fyouarenotgoingtousethe File holder chainforaprolongepderiodc , leanit witha brushand inch ( mm ) Part No . immersiteinanoil - paraffbinath . . 325 ( 8.25 ) Rapid - Micro 5605 750 4326 CarefuellyxamincehainforcrackisntheIinksordamaged . 325 ( 8.25 ) Rapid - Super 5605 750 4336 rivetswhileyouaresharpenianngdcleaninigt . Anydama - . 325 ( 8.25 ) Topic - Micro 5605 750 4321 gedorwornpartsmusbt ereplaceTd . henewpartsmust . 325 ( 8.25 ) Topic - Super 5605 750 4351 bereworketdo matchtheshapeandsizeoftheoriginal parts . 3 / 8 ( 9.32 ) Rapid - Standard 5605 750 4326 _ . / a ( 9.32 ) Rapid - Micro 5605 750 4326 ChainrepaircsanbecarriedoutwiththeSTIHLhandheld _ / a ( 9.32 ) Rapid - Super 5605 750 4336 chainbreakinagndrivetspinnintgool , theSTIHNLG1or . % ( 9.32 ) Topic _ Micro 5605 750 4321 NG5rivest pinnerasndtheSTIHNLG4chainbreaker . 3 / _ ( 9.32 ) Topic - Super 5605 750 4351 . 404 ( ! 0.26 ) Rapid - Standard 5605 750 4326 . 404 ( 10.26 ) Rapid - Micro 5605 750 4326 . 404 ( 10.26 ) Rapid - Super 5605 750 4336 Toolsforchain maintenance There is a range of chain sharpening aids and tools to suit the user's needs ( frequency of sharpening , time required etc . ) , File holders , which have reference marks for the filing angle , simplify chain sharpening and are available for all ty - pes of chain . The FG 1 filing tool attaches to the guide bar and shar - pens all types of chain . The STIHL FG 2 Filerite and USG universal electric sharpener are workshop tooIs suitable for sharpening all 51 types of chain .
Page: 54

Ordering Spare Parts For ordedng spare parts fill in below the model name of your power tool , the machine number as well as the part number of your chain and guide bar , This makes ordering of a new chain and bar easier as both parts are wearing parts . The part number for the chain sprocket which from time to time must be replaced as well is already filled in ; also the part numbers for the standard chain and guide bar are already filled in . When purchasing these parts it is sufficient to just men - tion the model and the respective part number . The machine number is found at the crankcase , the part number for the chain is marked on the chain box and the one of the guide bar can be found on the guide bar packaging . I - TTq - TK - rT1 - TTTTq Model description Serial number Chain part number CCCD Guide bar part number CEIl ] Sprocket part number CCDCCCE1 For recommended STIHL reduced kickback cutting attachments see section " Specifications , ' of this Owner's Manual , Guaranty for repairs can on ! y be given if the repair work is done by an authorized STIHL - Service Shop using original STIHL spare parts ,
Page: 55

Key to Symbols 1 = " Stop " position 3 = upper part : " warm start " position 2 = " RUN " position lower part : " cold start " position • 1 2 3 T A R T
Page: 56

Continuation o _ Important Safety , Precautions 13 . 4 , Do not allow other persons to be near the chain Keep the handles dry . clean , and free of oil or fuel mixture . saw when starting or cutting with the chain saw , Keep bystanders and animalsout ofthework area 14 Operate [ he chain saw only in weIFventilated 5 . Do not start cutting Until you have a clear work areas area , secure footing , and a planned retreat path ! 5o Do not operate a chain saw in a tree unless you from _ hefailing tree . have been specifically trained to do so . 6 Keep atl parts of your body away from the saw 16 . All chain saw service , other than the items listed in chain when the engine is running . the Owner's Manual maintenance instructions . 7 . Before you start the engine , make sure that the should be performed by competent chain saw saw chain is not contacting anything serwce personnel t For example , if improper tools are used to remove the flywheel or if an _ mproper 8 . Carry the chain saw with the engine stopped , the tool is used to hold the flywheel in order to re - guide bar and saw chain to the rear , and the muff - move the clutch , structural damage to the fly - ler away from your body . wheel could occur and could subsequently cause g , the flywheel to burst . ) Do not operate a chain saw that is damaged , im - properly adjusted , or not completely and securely 17 When transporting your chain saw , use the appro - assembled ; Be sure that the saw chain stops priate guide bar scabbard moving when the throttle control trigger is re - leased . 18 . Reduced kickback bars and low kickback chains are designed to reduce the risk of kickback injury . 10 . Shut off the engine before setting the chain saw Ask your STIHL dealer about these devices . down 11 . Use extreme caution when cutting small size brush and saplings because slender material may Note : catch the saw chain and be whipped toward you When using a chain saw for logging purposes , refer or pull you off batance . to the Code of Federal Regulations , Section 1910 . 12 , When cutting a limb that is under tension , be alert 266 ( 5 ) ; 2.5.1 of American National Standard Safety for springback so that you wilt not be struck when Requirements for Pulpwood Logging , ANSI 03.1 - 1978 : the tension in the wood fibers is released . and relevant state safety codes
Page: 57

5TIHI _ °
Page: 58

English / USA Contents This manual contains the safety Some Important Safety Precautions for Chain Saw Users . . . . . . . . . . . . . . . . . . . . . . . . 2 precautions and recommended cutting techniques outlined in STIHL chainsaw Safety Precautions . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Maintenance Chart . . . . . . . . . . . . . . . . . . . . . . . . . 26 Owner's Manuals . Even if you are an Main Parts of the Saw . . . . . . . . . . . . . . . . . . . . 28 experienced chainsaw user , it is in your own interests to familiarize yourself with the latest rules and regulations regarding safe use of your chainsaw . Please note that the illustrations on pages 28 and 29 show the chainsaws STIHL MS 210 , 230 , 250 . Other chainsaw models may have different parts and controls . You should b - therefore always refer to the Owner's Manual of your particular saw model . o Z _ Warning ! Because a chainsaw is a high - speed wood - cutting tool , some special safety precautions must be observed as with any other power saw to reduce the risk of personal injury . Careless or improper " r c use may cause serious or even fatal _ s injury . Read and follow all safety precautions in current Owner's Manual or Safety Manual . Always use two hands to operate the chainsaw . / _ Warning ! Avoid contact of bar tip with any object . < This can cause the guide bar to kick suddenly up and back , which may result o ¥ ' E in serious or fatal injury . To reduce the d risk of kickback injury STIHL recom - deL Oc ) mends the use of STIHL green labeled _ 5 reduced kickback bars and low kickback chains and a STIHL Quickstop chain brake . Contact your STIHL dealer or the STIHL distributor for your area if you do W _ not understand any of the instructions in this manual . STIHL o _ Chainsaw Safety Manual 1
Page: 59

English / USA Some Important Safety Precautions for Chain Saw Users A , Do not rely exclusively upon the safety 6 . Follow manufacturer's sharpening and maintenance instructions for devices built into your saw . As a A Summary of Warnings on the saw chain . kickback and other Selected chainsaw user , you should take several steps to keep your cutting jobs free from Risks - Taken Primarily from 7 . Only use replacement bars and accident or injury . ANSI B 175.1 ( See also " Safety chains specified by the Precautions " section of this manufacturer or the equivalent . 1 . With a basic understanding of Owner's Manual ) kickback , you can reduce or 8 . Reduced kickback bars and low eliminate the element of surprise . kickback chains are designed to AWarning ! Sudden surprise contributes to reduce the risk of kickback injury . Kickback may occur when the nose or accidents . Ask your STIHL dealer about these tip of the guide bar touches an object , or devices . 2 . Keep a good firm grip on the saw when the wood closes in and pinches with both hands , the right hand on the saw chain in the cut . Tip contact in B . the rear handle , and the left hand on some cases may cause a lightning fast Other Safety Precautions the front handle , when the engine is reverse reaction , kicking the guide bar running . Use a firm grip with thumbs up and back towards the operator . AWarning ! and fingers encircling the chainsaw Pinching the saw chain along the top of 1 . Do not operate a chainsawwith one handles . A firm grip will help you the guide bar may push the guide bar reduce kickback and maintain hand ! Serious injury to the operator , rapidly back towards the operator . Either helpers , bystanders , or any control of the saw . Don't let go . of these reactions may cause you to lose combination of these persons may 3 . Make sure the area in which you are control of the saw which could result in result from one - handed operation . A cutting is free from obstructions . Do serious personal injury . chainsaw is intended to be used not let the nose of the guide bar Section 5.11 of ANSI B 175.1 - 2000 sets with two hands . contact a log , branch , or any other certain performance and design criteria obstruction that could be hit while 2 . Do not operate a chainsaw when related to chainsaw kickback . STIH L has you are fatigued . you are operating the saw . developed a color code system using 3 . Use safety footwear ; snug - fitting 4 . Cut at high engine speeds . green and yellow to help you select a clothing ; protective gloves ; and eye , 5 . Do not overreach or cut above powerhead , bar and chain combination hearing , and head protection shoulder height . that complies with the kickback devices . requirements of the ANSI Standard . See the sections entitled " Safety Precautions " and " Specifications " of this manual . 2 Chainsaw Safety Manual
Page: 60

English / USA 4 . Use caution when handling fuel . 10 . Do not operate a chainsaw that is 17 . All chainsaw service , other than the Move the chainsaw at least 10 feet items listed in the Owner's Manual damaged , improperly adjusted , or ( 3 m ) from the fueling point before not completely and securely maintenance instructions , should be assembled . Be sure that the saw starting the engine . performed by competent chainsaw chain stops moving when the service personnel . ( For example , if 5 . Do not allow other persons to be throttle trigger is released . improper tools are used to remove near the chainsaw when starting or the flywheel or if an improper tool is cutting with the chainsaw . Keep 11 . Shut off the engine before setting used to hold the flywheel in order to the chainsaw down . bystanders and animals out of the remove the clutch , structural work area . 12 . Use extreme caution when cutting damage to the flywheel could occur 6 . Do not start cutting until you have a small size brush and saplings and could subsequently cause the clear work area , secure footing , and because slender material may catch flywheel to burst ) . a planned retreat path from the the saw chain and be whipped 18 . When transporting your chainsaw , falling tree . toward you or pull you off balance . use the appropriate chain guard 7 . Keep all parts of your body away 13 . When cutting a limb that is under ( scabbard ) . from the saw chain when the engine tension be alert for springback so Other important safety precautions are is running . that you will not be struck when the contained in the body of the Owner's tension in the wood fibers is 8 . Before you start the engine , make Manual especially in the General Safety released . sure that the saw chain is not Precautions . contacting anything . 14 . Keep the handles dry , clean , and free of oil or fuel mixture . Note : 9 . Carry the chainsaw with the engine stopped , the guide bar and saw 15 . Operate the chainsaw only in well - When using a chainsaw for logging ventilated areas . chain to the rear , and the muffler purposes , refer to the Code of Federal away from your body . Regulations , Parts 1910 and 1928 . 16 . Do not operate a chainsaw in a tree unless you have been specifically trained to do so . Chainsaw Safety Manual 3